Sk2 Neoplas Hanafi

of 32 /32
Muhammad Hanafi Qusyairi / 1102010181 LI 1 Memahami dan menjelaskan Karsinoma Hepatoseluler 1.1 Definisi Kanker hati (hepatocellular carcinoma) adalah suatu kanker yang timbul dari hati.Ia juga dikenal sebagai kanker hati primer atau hepatoma. Hati terbentuk dari tipe-tipe sel yang berbeda (contohnya, pembuluh-pembuluh empedu, pembuluh- pembuluh darah, dan sel-sel penyimpan lemak).Bagaimanapun, sel-sel hati (hepatocytes) membentuk sampai 80% dari jaringan hati.Jadi, mayoritas dari kanker-kanker hati primer (lebih dari 90 sampai 95%) timbul dari sel-sel hati dan disebut kanker hepatoselular atau Karsinoma. Karsinoma hepatoseluler (hepatoma) merupakan kanker hati primer yang paling sering ditemukan.Tumor ini merupakan tumor ganas primer pada hati yang berasal dari sel parenkim atau epitel saluran empedu atau metastase dari tumor jaringan lainnya. (Unggul, 2009) 1.2 Epidemiologi Karsinoma hepatoselular (hepatocellular carcinoma = HCC) jarang didapati di dunia barat, namun sering terjadi di daerah Sahara di Afrika serta di Asia Timur (kecuali Jepang). Keganasan primer pada hati ini menduduki tempat keenam dari keganasan yang tersering di dunia, dan tempat ketiga pembawa kematian- akibat kanker dengan nisbah mortalitas terhadap insidensnya sebesar 0,9. Di seluruh dunia, HCC menyumbang jumlah kematian lebih dari sejuta orang setiap tahunnya.Hepar sendiri merupakan tempat yang lazim bagi metastasis kanker yang berasal dari gastrointestinal, terutama dari daerah kolorektal. 1

Embed Size (px)

description

neoplas sekenario 1

Transcript of Sk2 Neoplas Hanafi

Muhammad Hanafi Qusyairi / 1102010181LI 1 Memahami dan menjelaskan Karsinoma Hepatoseluler1.1 Definisi Kanker hati (hepatocellular carcinoma) adalah suatu kanker yang timbul dari hati.Ia juga dikenal sebagai kanker hati primer atau hepatoma. Hati terbentuk dari tipe-tipe sel yang berbeda (contohnya, pembuluh-pembuluh empedu, pembuluh-pembuluh darah, dan sel-sel penyimpan lemak).Bagaimanapun, sel-sel hati (hepatocytes) membentuk sampai 80% dari jaringan hati.Jadi, mayoritas dari kanker-kanker hati primer (lebih dari 90 sampai 95%) timbul dari sel-sel hati dan disebut kanker hepatoselular atau Karsinoma.Karsinoma hepatoseluler (hepatoma) merupakan kanker hati primer yang paling sering ditemukan.Tumor ini merupakan tumor ganas primer pada hati yang berasal dari sel parenkim atau epitel saluran empedu atau metastase dari tumor jaringan lainnya. (Unggul, 2009)1.2 Epidemiologi Karsinoma hepatoselular (hepatocellular carcinoma = HCC) jarang didapati di dunia barat, namun sering terjadi di daerah Sahara di Afrika serta di Asia Timur (kecuali Jepang). Keganasan primer pada hati ini menduduki tempat keenam dari keganasan yang tersering di dunia, dan tempat ketiga pembawa kematian-akibat kanker dengan nisbah mortalitas terhadap insidensnya sebesar 0,9. Di seluruh dunia, HCC menyumbang jumlah kematian lebih dari sejuta orang setiap tahunnya.Hepar sendiri merupakan tempat yang lazim bagi metastasis kanker yang berasal dari gastrointestinal, terutama dari daerah kolorektal.

Tabel Faktor risiko kanker hati primer

Europe and United StatesJapanAfrica and Asia

EstimateRangeEstimateRangeEstimateRange

HBV224-582018-446040-90

HCV6012-726348-94209-56

Alcohol458-572015-33-11-41

Tobacco120-14409-5122-

OCPs-10-50--8-

AflatoxinLimited exposure

Other< 5---< 5-

(sumber emedicine.medscape.com)1.3 EtiologiDewasa ini hepatoma dianggap terjadi dari hasil interaksi sinergis multifaktor dan multifasik, melalui inisiasi, akselerasi, dan transformasi, serta peran onkogen dan gen terkait. Walaupun penyebab pasti hepatoma belum diketahui, tetapi sudah dapat diprediksi factor risiko yang memicu hepatoma, yaitu: 1. Virus hepatitis B (HBV)Karsinogenitas virus hepatitis B terhadap hati mungkin terjadi melalui proses inflamasi kronik, peningkatan proliferasi hepatosit, integrasi HBV DNA ke dalam DNA sel penjamu, dan aktifitas protein spesifik-HBV berintegrasi dengan gen hati. Pada dasarnya, perubahan hepatosit dari kondisi inaktif (quiescent) menjadi sel yang aktif bereplikasi menentukan tingkat karsinogenitas hati.Siklus sel dapat diaktifkan secara tidak langsung oleh kompensasi proliferatif merespons nekroinflamasi sel hati, atau akibat dipicu oleh ekspresi berlebihan suatu atau beberapa gen yang berubah akibat HBV.

1. Virus hepatitis C (HCV)Hepatokarsinogenesis akibat infeksi HCV diduga melalui aktifitas nekroinflamasi kronik dan sirosis hati. Dalam meta analisis penelitian, disimpulkan bahwa risiko terjadinya hepatoma pada pengidap infeksi HCV adalah 17 kali lipat dibandingkan dengan risiko pada bukan pengidap.

1. Sirosis hatiSirosis hati merupakan faktor risiko utama hepatoma di dunia dan melatarbelakangi lebih dari 80% kasus hepatoma.Komplikasi yang sering terjadi pada sirosis adalah asites, perdarahan saluran cerna bagian atas, ensefalopati hepatika, dan sindrom hepatorenal.Sindrom hepatorenal adalah suatu keadaan pada pasien dengan hepatitis kronik, kegagalan fungsi hati, hipertensi portal, yang ditandai dengan gangguan fungsi ginjal dan sirkulasi darah.Sindrom ini mempunyai risiko kematian yang tinggi.

1. AflatoksinAflatoksin B1 (AFB1) merupakan mikotoksin yang diproduksi oleh jamur Aspergillus.Dari percobaan binatang, diketahui bahwa AFB1 bersifat karsinogenik.Metabolit AFB1 yaitu AFB 1-2-3-epoksid merupakan karsinogen utama dari kelompok aflatoksin yang mampu membentuk ikatan dengan DNA maupun RNA. Salah satu mekanisme hepatokarsinogenesisnya ialah kemampuan AFB1 menginduksi mutasi pada kodon 249 dari gen supresor tumor p53.

1. ObesitasObesitas merupakan faktor risiko utama untuk non-alcoholic fatty liver disease (NAFLD), khususnya nonalcoholic steatohepatitis (NASH) yang dapat berkembang menjadi sirosis hati dan kemudian dapt berlanjut menjadi Hepatocelluler Carcinoma (HCC).

1. Diabetes mellitusPada penderita DM, terjadi perlemakan hati dan steatohepatis non-alkoholik (NASH). Di samping itu, DM dihubungkan dengan peningkatan kadar insulin dan insulin-like growth hormone faktors (IGFs) yang merupakan faktor promotif potensial untuk kanker.

1. AlkoholMeskipun alkohol tidak memiliki kemampuan mutagenik, peminum berat alkohol berisiko untuk menderita hepatoma melalui sirosis hati alkoholik.

1. Faktor risiko lainBahan atau kondisi lain yang merupakan faktor risiko hepatoma namun lebih jarang ditemukan, antara lain:1. Penyakti hati autoimun : hepatitis autoimun, PBS/sirosis bilier primer1. Penyakit hati metabolik : hemokromatosis genetik, defisiensi antiripsin-alfa1, Wilson disease1. Kontrasepsi oral1. Senyawa kimia : thorotrast, vinil klorida, nitrosamine, insektisida organoklorin, asam tanik

1.4 KlasifikasiBeberapa sistem staging HCC telah diajukan dan dipakai, antara lain klasifikasi TNM, klasifikasi menurut Okuda, BCLC (Barcelona Clinic Liver Cancer), CLIP (Cancer ofLiver Italian Program), GRETCH (Group dEtute et de Traitement du CarcinomeHepatocellulaire), CUPI (Chinese University Prognostic Index) serta JIS (JapaneseIntegrated Staging).Klasifikasi menurut TNM disusun oleh The International Cooperative Study Group on Hepatocellular Carcinoma berdasarkan evaluasi survival dari 557 pasien HCC (lihatTabel 1).Sistem klasifikasi CLIP, GRETCH dan CUPI masing-masing merupakan hasilanalisis multivariat berbagai faktor survival pasien HCC dalam suatu penelitian kohort.

Okuda dkk. menyadari pentingnya ukuran tumor maupun fungsi hepar sebagai faktorfaktor terpenting dalam penentuan prognosis HCC, namun penilaian mereka dalam hal ukuran tumor masih kasar (pembedaan berdasarkan ukuran lebih besar atau kurang daripada 50% ukuran hepar), sementara pengukuran fungsi hepar hanya didasarkan pada adanya asites serta pada kadar albumin dan bilirubin serum (Tabel 2).

Sistem JIS menggunakan skoring klasifikasi klinis Child-Turcotte-Pugh (lihat Tabel 3) bagi pengukuran fungsi hepar, dan sistem staging TNM untuk penilaian besar tumor (seperti tergambar pada Tabel 4).

Sistem BCLC (Tabel 5) selain memakai klasifikasi Child-Turcotte-Pugh untuk menilai fungsi hepar, juga menggunakan kriteria ukuran tumor yang lebih akurat serta memasukkan kriteria penilaian akan adanya trombosis vena porta. Sistem terakhir ini dinilai banyak kalangan peneliti sebagai sistem yang cukup lengkap dalam stratifikasi dan penentuan prognosis pasien HCC. Saat ini American Association for the Study of LiverDiseases (AASLD) dan European Association for the Study of the Liver (EASL) telah menyepakati pemakaian system BCLC sebagai sistem staging bersama.

Klasifikasi Child-Pugh

1.5 PatofisiologiInflamasi, nekrosis, fibrosis, dan regenerasi dari sel hati yang terus berlanjut merupakan proses khas dari sirosis hepatis yang juga merupakan proses dari pembentukan hepatoma walaupun pada pasien-pasien dengan hepatoma, kelainan sirosis tidak selalu ada. Virus hepatitis, dikarenakan protein tersebut merupakan suatu RNA. RNA akan berkembang dan mereplikasi diri di sitoplasma dari sel hati dan menyebabkan suatu perkembangan dari keganasan yang nantinya akan menghambat apoptosis dan meningkatkan proliferasi sel hati. Sel-sel meregenerasi sel-sel hati yang rusak menjadi nodul-nodul yang ganas sebagai respons dari adanya penyakit yang kronik yang disebabkan oleh infeksi virus nodul sehingga mulai terbentuk karsinoma hepatoseluler.

Etiologi:-HBV-HCV-Alcohol-Aflatoxin-Obat-obatan bahan kimia-radiasi

Peningkatan perputaran sel hati yang diinduksi oleh injuryRegenerasi kronikKerusakan oksidatif DNA

Perubahan genetic (perubahan kromosom,aktifitas onkogenik selular,inaktivasi gen supresor tumor,invasi pertumbuhan angiogenik,aktivasi telomerase)

Transformasi malignan

Menyebar melalui 4 jalur:Pertumbuhan sentrifungalPerluasan parasinusoidalPenyebaran system vena portalMetastasis jauh

Perjalanan penyakit cepat bila tidak segera diobati, sebagian besar pasien meninggal dalam 3-6 bulan setelah diagnosis.Perjalanan klinis keganasan hati tidak berbeda diantara pasien yang terinfeksi kedua virus dengan hanya terinfeksi salah satu virus yaitu HBV dan HCV.Infeksi kronik ini sering menimbulkan sirosis yang merupakan faktor resiko penting untuk karsinoma hepatoseluler.Unit fungsional dasar dari hepar disebut lobul dan unit ini unik karena memiliki suplai darah sendiri.Seiring dengan berkembangnya inflamasi pada hepar, pola normal pada hepar terganggu.Gangguan terhadap sulai darah normal pada sel-sel hepar ini menyebabkan nekrosis dan kerusakan sel-sel hepar.Inflamasi pada hepar terjadi karena invasi virus HBV atau HCV akan mengakibatkan kerusakan sel hati dan duktuli empedu intrahepatik (empedu yang membesar tersumbat oleh tekanan nodul malignan dalam hilus hati) sehingga menimbulkan nyeri. Hal ini dimanifestasikan dnegan adanya rasa mual dan nyeri di ulu hati. Sumbatan intrahepatik dapat menimbulkan hambatan pada aliran portal sehingga tekanan portal akan naik dan terjadi hipertensi portal.Timbulnya asites karena penurunan sintesa albumin pada proses metabolism protein sehingga terjadi penurunan tekanan osmotic dna peningkatan cairan atau penimbunan cairan didalam rongga peritoneum.gangguan metabolism protein yang mengakibatkan penurunan sintesa fibrinogen protrombin dan terjadi penurunan faktor pembekuan darah sehinga dapat menimbulkan perdarahan.Ikterus timbul karena kerusakan sel parenkim hati dan duktuli empedu intrahepatik maka terjadi kesukaran pengangkutan tersebut dalam hati.akibatnya bilirubin tidak sempurna dikeluarkan melalui duktus hepatica, karena terjadi retensi (akibat kerusakan sel ekskresi) dan regurgitasi pada duktuli, empedu belum mengalami konjugasi (bilirubin indirek), maupun bilirubin yang sudah mengalami konjugasi (bilirubin direk).Jadi, ikterus yang timbul disini terutama disebabkan karena kesukaran dalam pengangkutan, konjugasi dan eksresi bilirubin oleh karena nodul tesebut menyumbat vena portal atau bila jaringan tumor tertanam dalam ronga peritoneal.Peningkatan kadar bilirubin terkonjugasi dapat disertai peningkatan garam-garam empedu dalam darah yang akan menimbulkan gatal-gatal pada ikterus. Gangguan metabolism karbohidrat, lemak, dan protein menuebabkan penurunakan glikogenesis dan glukoneogenesis sehingga glikogen dalam hepar berkuranh, glikegenolisis menurun dan glukosa dalam darah berkurang akibatnya timbul keletihan.Kerusakan sel hepar juga dapat mengakibatkan penurunan fungsi penyimpanan vitamin dan mineral sehingga terjadi defisiensi pada zat besi, vitamin A, vitamin K, vitamin D, vitamin E, dll. Defiseinsi zat besi dapat mengakibatkan keletihan , defisiensi vitamin A mengakibatkan gangguan penglihatan, defisiensi vitamin K mengakibatkan resiko terjadi perdarahan, defisiensi vitamin D mengakibatkan demineralisasi tulang dan defisiensi vitamin E berpengaruh pada integritas kulit.

1.6 Manifestasi KlinisI. Hepatoma fase subklinisFasesubklinis atau stadium dini adalah pasien yang tanpa gejala dan tanda fisik hepatoma yang jelas, biasanya ditemukan melalui pemeriksaan AFP dan teknik pencitraan. Yang dimaksud kelompok risiko tinggi hepatoma umumnya adalah: masyarakat di daerah insiden tinggi hepatoma; pasien dengan riwayat hepatitis atau HBsAg positif; pasien dengan riwayat keluarga hepatoma; pasien pasca reseksi hepatoma primer.II. Hepatoma fase klinisHepatoma fase klinis tergolong hepatoma stadium sedang, lanjut, manifestasi utama yang sering ditemukan adalah:a. Nyeri abdomen kanan atas: hepatoma stadium sedang dan lanjut sering datang berobat karena kembung dan tidak nyaman atau nyeri samar di abdomen kanan atas. Nyeri seperti tertusuk, sebagian merasa area hati terbebat kencang, disebabkan tumor tumbuh dengan cepat hingga menambah regangan pada kapsul hati. b. Perut kembung: timbul karena massa tumor sangat besar, asitesdan gangguan fungsi hati.c. Anoreksia: timbul karena fungsi hati terganggu, tumor mendesak GIT, perut tidak bisa menerima makanan dalamjumlah banyak karena terasa begah.d. Letih, berat badan: dapat disebabkan metabolit dari tumor ganasdan berkurangnya masukan makanan pada tubuh.e. Demam: timbul karena nekrosis tumor, disertai infeksi, metabolit tumor, jika tanpa bukti infeksi disebut demam kanker,umumnya tidak disertai menggigil.f. Ikterus: kuningnya sclera dan kulit, umumnyakarena gangguan fungsi hati, biasanya sudah stadium lanjut, dapat menyumbat kanker di saluran empedu atau tumormendesak saluran empedu hingga timbul ikterus obstruktif.g. Asites: perut membuncit dan pekak bergeser, sering disertaiudem kedua tungkai.h. Lainnya: selain itu terdapat kecenderungan perdarahan, diare,nyeri bahu belakangkanan, udem kedua tungkai bawah, kulit gatal dan lainnya, jugamanifestasi sirosishati seperti splenomegali, palmar eritema, lingua hepatik, spidernevi, venodilatasi dinding abdomen. Pada stadium akhir hepatoma sering timbulmetastasis paru,tulang dan banyak organ lain.

1.7 Diagnosis dan Diagnosis BandingKriteria diagnosa Kanker Hati Selular (KHS) menurut PPHI (Perhimpunan Peneliti Hati Indonesia), yaitu: 1. Hati membesar berbenjol-benjol dengan/tanpa disertai bising arteri. 2. AFP (Alphafetoprotein) yang meningkat lebih dari 500 mg per ml. 3. Ultrasonography (USG), Nuclear Medicine, Computed Tomography Scann (CT Scann), Magnetic Resonance Imaging (MRI), Angiography, ataupun Positron Emission Tomography (PET) yang menunjukkan adanya KHS. 4. Peritoneoscopy dan biopsi menunjukkan adanya KHS. 5. Hasil biopsi atau aspirasi biopsi jarum halus menunjukkan KHS. Diagnosa KHS didapatkan bila ada dua atau lebih dari lima kriteria atau hanya satu yaitu kriteria empat atau lima.Berikut gambaran patologi anatomi dan histologinya :

1: Large hepatocellular carcinoma.Biasanya sel-sel ini menyerupai hati yang normal dengan trabekular padat atau prosessus seperti jari tangan yang padat, biasanya sel tumor lebih kecil dari sel hati normal.

2 : Photomicrograph of a liver demonstrating hepatocellular carcinoma.Histologi : memperlihatkan sel tumor dengan sotoplasma yang jernih tak berwarna, sering berbusa tau bervakuolisasi lipid dan glikogen berlebihan dalam sitoplasma. Sering keadaan ini berhubungan dengan hipoglekemia dan hiperkolesterolemia serta mempunya prognosis yang bervariasi.Pemeriksaan Radiologi1. Ultrasonografi AbdomenUltrasonography (USG) merupakan salah satu imaging diagnostic untuk memeriksa alat-alat tubuh, dimana kita dapat mempelajari bentuk, ukuran anatomis, gerakan serta hubungan dengan jaringan sekitarnya.10Untuk meminimalkan kesalahan hasil pemeriksaan AFP, pasien sirosis hati dianjurkan menjalani pemeriksaan setiap 3 bulan.Untuk tumor kecil pada pasien dengan risiko tinggi, USG lebih sensitif daripada AFP serum berulang.Sensitifitas USG untuk neoplasma hati berkisar antara 70-80%.1Secara umum pada USG sering diketemukan adanya hepar yang membesar, permukaan yang bergelombang dan lesi-lesi fokal intra hepatik dengan struktur eko yang berbeda dengan parenkim hati normal.Biasanya menunjukkan struktur eko yang lebih tinggi disertai nekrosis sentral berupa gambaran hipoekoik sampai anekoik akibat adanya nekrosis, tepinya irregular. Yang sangat sulit adalah menentukan hepatoma pada stadium awal di mana gambaran struktur eko yang masih isoekoik dengan parenkim hati normal. 9Modalitas imaging lain seperti CT-scan, MRI, dan angiografi kadang diperlukan untuk mendeteksi hepatoma, namun karena kelebihannya, USG masih tetap merupakan alat diagnostic yang paling popular dan bermanfaat.1

Gambar 4.USG menunjukkan massa hyperechoic mewakili karsinoma hepatoseluler. Di kutip dari kepustakaan 5.

Hepatocellular carcinoma, dikutip dari kepustakaan nomor 14

2. CT ScanCT telah menjadi parameter pemeriksaan rutin penting untuk diagnosis lokasi dan sifat hepatoma. CT dapat membantu memperjelas diagnosis, menunjukkan lokasi tepat, jumlah dan ukuran tumor dalam hati, hubungannya dengan pembuluh darah dan penentuan modalitas terapi.9

Gambar 5.CT scan hepatoma, dikutip dari kepustakaan nomor 14

3. MRIMRI merupakan teknik pemeriksaan nonradiasi, tidak memakai kontras berisi iodium, dapat secara jelas menunjukkan struktur pembuluh darah dan saluran empedu dalam hati, juga cukup baik memperlihatkan struktur internal jaringan hati dan hepatoma, sangat membantu dalam menilai efektivtas aneka terapi. Dengan zat kontras spesifik hepatosit dapat menemukan hepatoma kecil kurang dari 1 cm dengan angka keberhasilan 55%.3

Gambar MRI yang menunjukkan tiga wilayah yang terpisah (ditunjukkan dengan panah) dari metastasis hati.Di kutip dari kepustakaan 16.4. Angiografi arteri hepatikaSejak tahun 1953 Seldinger merintis penggunaan metode kateterisasi arteri femoralis perkuran untuk membuat angiografi organ dalam, kini angiografi arteri hepatika selektif atau supraselektif sudah menjadi salah satu metode penting dalam diagnosis hepatoma.Namun karena metode ini tergolong invasive, penampilan untuk hati kiri dan hepatoma tipe avaskular agak kurang baik.Angiografidilakukanmelaluimelaluiarterihepatika. 3, 11

Gambar angiografi dikutip dari kepustakaan nomor 18

5. Gambaran PETPositron Emission Tomography (PET) yang merupakan alat pendiagnosis kanker menggunakan glukosa radioaktif yang dikenal sebagai flourine18 atau Fluorodeoxyglucose (FGD) yang mampu mendiagnosa kanker dengan cepat dan dalam stadium dini. Caranya, pasien disuntik dengan glukosa radioaktif untuk mendiagnosis sel-sel kanker di dalam tubuh. Cairan glukosa ini akan bermetabolisme di dalam tubuh dan memunculkan respons terhadap sel-sel yang terkena kanker.

Pasien diinjeksikan FGD, kemudian bisa dimonitor radioaktinya.

Tampak FGD mengelilingi tumor, kemudian divalidasi dengan US Color Dopler dan histologi

Diambil jaringan hatinya dan ditemukan bagian yang nekrosis.

Pemeriksaan Laboratorium1. Penanda TumorAlfa-fetoprotein (AFP) adalah protein serum normal yang disintesis oleh sel hati fetal, sel yolk-sac dan sedikit sekali oleh saluran gastrointestinal fetal.Rentang normal AFP serum adalah 0-20 ng/mL. Kadar AFP meningkat pada 60-70% pada pasien hepatoma, dan kadar lebih dari 400 ng/mL adalah diagnostic atau sangat sugestif hepatoma.

1. Biopsi hatiBiopsihatiperkutandapatdiagnostikjikasampeldiambildaridaerahlokaldenganultrasoundatauCT. karenatumor inicenderungakan ke pembuluh darah, biopsiperkutanharusdilakukandenganhati-hati. pemeriksaansitologicairanasitesadalahselalunegatifuntuktumor. kadang-kadanglaparoskopiatauminilaparatomi, untuk biopsihatidapatdigunakan. pendekataninimemilikikeuntungantambahankadangmengidentifikasipasienyangmemilikitumorcocokuntukhepatectomyparsial.

Diagnosis Banding

1. HemangiomaHemangioma merukapakan tumor terlazim dalam hati, tumor ini biasanya subkapsular pada konveksitaslobus hepatis dexter dan kadang-kadang berpedunkulasi.Ultrasonografi memperlihatkan bercak-bercak ekogenik soliter dengan batas licin berbatas tegas.Pada foto polos biasanya memperlihatkan kapsul berkalsifikasi.

1. Abses heparSangat sukar dibedakan anatara abses piogenik dan amebik.Biasanya sangat besar, kadang-kadang multilokular.Struktur eko rendah sampai cairan (anekoik) dengan adanya bercak-bercak hiperekoik (debris) di dalamnya.Tepinya tegas, irregular yang makin lama makin bertambah tebal.

Gambar 6. Abses hepar , dikutip dari kepustakaan nomor 141. Tumor metastasisHepar adalah organ yang paling sering menjadi tempat tumor metastasi setelah kelenjar limfe.Gambaran eko bergantung pada jenis asal tumor primer.Jadi dapat berupa struktur eko yang mungkin lebih tinggi atau lebih rendah daripada jaringan hati normal.

1.8 Penatalaksanaan1. Terapi Operasi1. Reseksi HepatikUntuk pasien dalam kelompok non sirosis yang biasanya mempunyai fungsi hati normal pilihan utama terapi adalah reseksi hepatik.Namun untuk pasien sirosis diperlukan kriteria seleksi karena operasi dapat memicu timbulnya gagal hati yang dapat menurunkan angka harapan hidup.Kontra indikasi tindakan ini adalah metastasis ekstrahepatik, hepatoseluler karsinoma difus atau multifokal, sirosis stadium lanjut dan penyakit penyerta yang dapat mempengaruhi ketahanan pasien menjalani operasi.Kontraindikasi absolut bagi reseksi adalah adanya metastasis jauh, trombosis vena porta utama, atau adanya trombosis vena cava inferior.Penyebab tersering mortalitas pascaoperasi adalah kegagalan hati, perdarahan, serta komplikasi sepsis, yang dapat diperkecil kemungkinannya dengan seleksi pasien secara baik. Pengembangan teknik operasi memungkinkan diangkatnya jaringan hepar yang mengandung nodul HCC secara selektif dengan teknik segmentektomi, atau bahkan secara superselektif dengan subsegmentektomi (tindakan ini dapat dikerjakan dengan panduan USG intraoperasi, yang dikenal sebagai prosedur Makuuchi)

1. Transplantasi HatiTransplantasi hati memberikan kemungkinan untuk menyingkirkan tumor dan menggantikan parenkim hati yang mengalami disfungsi.Kematian pasca transplantasi tersering disebabkan oleh rekurensi tumor di dalam maupun di luar transplant.Tumor yang berdiameter kurang dari 3 cm lebih jarang kambuh dibandingkan dengan tumor yang diameternya lebih dari 5 cm. Untuk seleksi pasien HCC calon penerima transplan, secara umum digunakan kriteria Milan, yaitu pasien dengan lesi tunggal berukuran 5 cm, atau lesi kurang dari 3 buah dan masing-masing berukuran 3 cm. Di Eropa, Barcelona Clinic Liver Cancer Staging and Treatment Approach telah menyusun bagan alur klasifikasi HCC beserta penatalaksanaannya. Berdasarkan kriteria BCLC, pasien HCC dibagi menjadi stadium sangat dini, dini, menengah, lanjut, dan terminal.Transplantasi hati diperuntukkan pasien HCC stadium sangat dini dengan peningkatan tekanan vena porta dan stadium dini tanpa penyulit. Pasien HCC penerima transplantasi hati sesuai algoritma ini dilaporkan memiliki angka survival lima tahun sebesar 60-70%

1. Terapi Operatif non ReseksiKarena tumor menyebar atau alasan lain yang tidak dapat dilakukan reseksi, dapat dipertimbangkan terapi operatif non reseksi mencakup injeksi obat melalui kateter transarteri hepatik atau kemoterapi embolisasi saat operasi, kemoterapi melalui keteter vena porta saat operasi, ligasi arteri hepatika, koagulasi tumor hati dengan gelombang mikro, ablasi radiofrekuensi, krioterapi dengan nitrogen cair, efaforisasi dengan laser energi tinggi saat operasi, injeksi alkohol absolut intratumor saat operasi.3

1. Terapi Lokal1. Ablasi radiofrekuensi (RFA)Ini adalah metode ablasi local yang paling sering dipakai dan efektif dewasa ini.Elektroda RFA dimasukkan ke dalam tumor, melepaskan energi radiofrekuensi hingga jaringan tumor mengalami nekrosis koagulatifn panas, denaturasi, jadi secara selektif membunuh jaringan tumor.Satu kali RFA menghasilkan nekrosis seukuran bola berdiameter 3-5 cm sehingga dapat membasmi tuntas mikrohepatoma, dengan hasil kuratif.

1. Injeksi alkohol (etanol) absolut intratumor perkutan (PEI)Di bawah panduan teknik pencitraan, dilakukan pungsi tumor hati perkutan, ke dalam tumor disuntikkan alkohol absolut.Penggunaan umumnya untuk hepatoma kecil yang tak sesuai direseksi atau terapi adjuvant pasca kemoembolisasi arteri hepatik.3 Komplikasi PEI yang dapat muncul adalah timbulnya nyeri abdomen yang dapat terjadi akibat kebocoran etanol ke dalam rongga peritoneal.Kontraindikasi PEI meliputi adanya asites yang masif, koagulopati, atau ikterus obstruksi, yang semua dapat meningkatkan risiko perdarahan dan peritonitis bilier pasca-tindakan.Angka survival 3 tahun bagi pasien sirosis dengan nodul tunggal HCC yang ditangani dengan PEI dilaporkan sebesar 70%.

1. Kemoembolisasi arteri hepatik perkutanKemoembolisasi arteri hepatik transketer (TAE, TACE) merupakan cara terapi yang sering digunakan untuk hepatoma stadium sedang dan lanjut yang tidak sesuai dioperasi reseksi. Hepatoma terutama mendapat pasokan darah dari arteri hepatik, setelah embolisasi arteri hepatik, nodul kanker menjadi iskemik, nekrosis, sedangkan jaringan hati normal mendapat pasokan darah terutama dari vena porta sehingga efek terhadap fungsi hati secara keseluruhan relative kecil.Sesuai digunakan untuk tumor sangat besar yang tak dapat direseksi, tumor dapat direseksi tapi diperkirakan tak tahan operasi, hepatoma rekuren yang tak dapat direseksi, hepatoma rekuren yang tak dapat direseksi, pasca reseksi hepatoma, suksek terdapat residif, dll.

1. KemoterapiHepatoma relatif kurang peka terhadap kemoterapi, efektivas kemoterapi sistemik kurang baik. Yang tersering dipaki adalah 5FU, ADR, MMC, karboplatin, MTX, 5-FUDR, DDP, TSPA, kamtotesin, dll.3Kemoterapi SistemikBanyak studi yang meneliti terapi sistemik untuk HCC, khususnya pada pasien yang inoperabel, dan banyak pula yang hasilnya tidak terlalu menggembirakan. Terapi kemoterapi sistemik yang diberikan dapat digolongkan ke dalam beberapa kelompok, antara lain: Kemoterapi sitotoksik (meliputi etoposide, doxorubicin, epirubicin, cisplatin, 5-fluorouracil, mitoxantrone, fludarabine, gemcitabine, irinotecan, nolatrexed)

Terapi hormonalEstrogen secara in vitro terbukti memiliki efek merangsang proliferasi hepatosit, dan secara in vivo bisa memicu pertumbuhan tumor hepar.Obat antiestrogen, tamoxifen, dipakai karena bisa menurunkan jumlah reseptor estrogen di hepar.Namun hasil studi random fase III yang dilakukan oleh Barbare ternyata tidak menunjukkan peningkatan survival.

Terapi somatostatin (ocreotide, lanreotide) Somatostatin memiliki aktivitas antimitosis terhadap berbagai tumor non-endokrin, dan sel-sel HCC memiliki reseptor somatostatin.Karena itu analog somatostatin dipakai untuk menangani pasien dengan HCC yang lanjut.Sebuah penelitian random awal oleh Kouroumalis dkk.menunjukkan perbaikan survival pada pasien yang diberi terapi ocreotide secara subkutan, namun studi lainnya oleh Becker dkk. menunjukkan tidak ada peningkatan survival pada pemberian ocreotide aksi lama (lanreotide).

Terapi dengan thalidomide (sebagai terapi tunggal atau kombinasi dengan epirubicin atau interferon)Thalidomide yang awalnya dikembangkan pada tahun 1960-an sebagai sedatif, baru-baru ini dievaluasi ulang perannya untuk obat antikanker. Penggunaannya pada pasien HCC lanjut terutama berdasarkan efek anti-angiogeniknya.Studi fase II telah dibuat untuk mengukur kemangkusan thalidomide sebagai terapi tunggal atau dalam kombinasi dengan epirubicin atau dengan interferon menunjukkan aktivitas yang terbatas pada pengobatan HCC.

Terapi interferon Interferon yang biasa dipakai untuk terapi hepatitis viral telah dicobakan untuk pengobatan HCC.Mekanisme terapinya ada beberapa, meliputi efek langsung antivirus, efek imunomodulasi, serta efek antiproliferasi langsung maupun tak langsung.Beberapa studi awal menunjukkan pemberian interferon dosis tinggi meningkatkan angka survival, namun ada toksisitas karena obat pada penerimanya. Penelitian lain menunjukkan bahwa pemberian interferon dosis rendah tidak menunjukkan efek perbaikan yang bermakna.

Molecularly targeted therapy Erlotinib yang merupakan inhibitor tirosin-kinase yang bekerja pada reseptor EGF (epidermal growth factor), menunjukkan kemangkusan sebagai pengobatan HCC lanjut.Sunitinib adalah inhibitor tirosin-kinase multitarget dengan kemampuan antiangiogenesis pula. Sebuah studi fase II memperlihatkan pemberian sunitinib pada pasien HCC yang inoperabel memberikan hasil survival keseluruhan sebesar 9,8 bulan.(46) Sorafenib adalah inhibitor multi-kinase oral yang menghambat proliferasi sel tumor dengan membidik jalur sinyal intrasel pada tingkat Raf-1 dan B-raf serin-treonin-kinase dan juga menghasilkan efek anti-angiogenik dengan membidik reseptor EGF (endothelial growth factor) 1, 2, dan 3 serta reseptor platelet derived growth factor dari tirosin-kinase beta. Obat ini cukup mahal, namun manfaat klinisnya masih sangat terbatas.

1. RadioterapiRadioterapi eksternal sesuai untuk pasien dengan lesi hepatoma yang relatif terlokalisasi, medan radiasi dapat mencakup seluruh tumor, selain itu sirosis hati tidak parah, pasien dapat mentolerir radioterapi. Radioterapi umumnya digunakan secara bersama metode terapi lain seperti herba, ligasi arteri hepatik, kemoterapi transarteri hepatik, dll. Sedangkan untuk kasus metastasis stadium lanjut dengan metastasis tulang, radiasi lokal dapat mengatasi nyeri.Dapat juga memakai biji radioaktif untuk radioterapi internal terhadap hepatoma.Klasifikasi Radioterapi: Terapi Radiasi Eksterna Terapi Radiasi Interna menggunakan selective internal radiotherapy (SIRT) dengan radioisotop SIRT dengan 90Ytrium microsphereBerikut bagan alur penatalaksanaan hepatoma (HCC)

The Barcelona-Clinic Liver Cancer (BCL\C) approach to hepatocellular carcinoma management. Adapted from Llovet JM, Fuster J, Bruix J, Barcelona-Clinic Liver Cancer Group. The Barcelona approach: diagnosis, staging, and treatment of hepatocellular carcinoma. Liver Transpl. Feb 2004;10(2 Suppl 1):S115-20.

1.9 KomplikasiKomplikasi yang mungkin dapat terjadi adalah: 1. Metastasis2. RupturInsiden ruptur spontan hepatoma mencapai 11% 26% di negara-negara timur, sedangkan di negara-negara barat hanya mencapai 2% 3%.Tanda -tanda rupture spontan hepatoma sering didapat hanya dengan tanda-tanda seperti nyeri perut kanan bawah karena darah turun mengikuti Para colic gutter kanan. Tetapi dapat juga dengan tanda-tanda darah dalam peritoneum dan syok hemoragik. Sakit perut di kanan atas yang tiba-tiba merupakan pertanda terjadinya rupture.Tumor yang akan rupture terletak dekat permukaan dan dapat di deteksi dengan CT Scan yang tampak menmonjol keluar. Ruptur terjadi karena arteri kehilangan elastin dan degradasi dari kolagen. Terapi dahulu di lakukan dengan tindakan agresif operasi / reseksi hati, tetapi angka kematiannya tinggi.

Komplikasi Hepatoma paling sering adalah perdarahan varises esofagus, koma hepatik, koma hipoglikemi, ruptur tumor, infeksi sekunder, metastase ke organ lain.(Sjamsuhidajat, 2004).Sedangkan menurut Suratun (2010 : hlm 301) komplikasi dari kanker hati adalah:a. Perdarahan berhubungan dengan perubahan pada faktor pembekuanb. Fistulabiliaris.c. Infeksi pada luka operasi.d. Masalah pulmonal.e. Anoreksia dan diare merupakan efek yang merugikan dari pemakaian agens kemoterapiyang spesifik 5-FU dan FUDR.f. Ikterik dan asites jika penyakit sudah pada tahap lanjut

1.10 PencegahanPencegahan Primordial Pencegahan primordial adalah pencegahan yang dilakukan terhadap orang yang belum terpapar faktor risiko. Pencegahan yang dilakukan antara lain :1. Konsumsi makanan berserat seperti buah dan sayur serta konsumsi makanan dengan gizi seimbang. 2. Hindari makanan tinggi lemak dan makanan yang mengandung bahan pengawet/ pewarna. 3. Konsumsi vitamin A, C, E, B kompleks dan suplemen yang bersifat antioksidan, peningkat daya tahan tubuh.

Pencegahan Primer Pencegahan primer merupakan pencegahan yang dilakukan terhadap orang yang sudah terpapar faktor risiko agar tidak sakit. Pencegahan primer yang dilakukan antara lain dengan :1. Memberikan imunisasi hepatitis B bagi bayi segera setelah lahir sehingga pada generasi berikutnya virus hepatitis B dapat dibasmi. 2. Memberikan penyuluhan kepada masyarakat tentang virus hepatitis (faktor-faktor risiko kanker hati) sehingga kejadian kanker hati dapat dicegah melalui perilaku hidup sehat. 3. Menghindari makanan dan minuman yang mengandung alkohol karena alkohol akan semakin meningkatkan risiko terkena kanker hati.4. Menghindari makanan yang tersimpan lama atau berjamur karena berisiko mengandung jamur Aspergillus flavus yang dapat menjadi faktor risiko terjadinya kanker hati. 5. Membatasi konsumsi sumber radikal bebas agar dapat menekan perkembangan sel kanker dan meningkatkan konsumsi antioksidan sebagai pelawan kanker sekaligus mangandung zat gizi pemacu kekebalan tubuh.

Pencegahan Sekunder Pencegahan sekunder merupakan upaya yang dilakukan terhadap orang yang sudah sakit agar lekas sembuh dan menghambat progresifitas penyakit melalui diagnosis dini dan pengobatan yang tepat.Pencegahan Tersier Pencegahan tersier yang dapat dilakukan yaitu berupa perawatan terhadap penderita kanker hati melalui pengaturan pola makan, pemberian suplemen pendukung penyembuhan kanker, dan cara hidup sehat agar dapat mencegah kekambuhan setelah operasi.

1.11 Prognosis

Sebagian besar kasus HCC berprognosis buruk karena tumor yang besar/ ganda dan penyakit hati stadium lanjut serta ketiadaan atau ketidakmampuan penerapan terapi yang berpotensi kuratif (reseksi, transplantasi, dan PEI).Stadium tumor, kondisi umum kesehatan, fungsi hati, dan intervensi spesifik mempengaruhi prognosis pasien HCC.Jika tidak diterapi, survival rata-rata alamiah adalah 4,3 bulan. Kausa kematian umumnya adalah kegagalan sistemik, perdarahan saluran cerna atas, koma hepatic dan ruptur hati.Faktor yang mempengaruhi prognosis terutama ialah ukuran dan jumlah tumor, ada tidaknya trombus kanker dan kapsul, derajat sirosis yang menyertai, metode terapi, dllLI 2 Memahami dan menjelaskan Hukum Transplantasi Menurut Pandangan IslamHukum tentang transplantasi sangat bermacam-macam, ada yang mendukung dan ada pula yang menolaknya. Oleh karena itu, dalam pembahasan ini akan menggabungkan hukum-hukum dari beberapa sumber yaitu dari Abuddin (Ed) (2006) dan Zamzami Saleh (2009), sebagai berikut:Transplantasi organ ketika masih hidupPendapat 1: Hukumnya tidak Boleh (Haram).Meskipun pendonoran tersebut untuk keperluan medis (pengobatan) bahkan sekalipun telah sampai dalam kondisi darurat.Dalil1: Firman Allah SWT Dan janganlah kamu membunuh dirimu sendiri, sesungguhnya Allah maha penyayang kepadamu ( Q.S.An-Nisa:4:29) dan Firman Allah SWT Dan Janganlah kamu jatuhkan dirimu dalam kebinasaan dan berbuat baiklah sesungguhnya Allah mencintai orang-orang yang berbuat baik (Q.S.Al-Baqarah :2:195).Maksudnya adalah bahwa Allah SWT melarang manusia untuk membunuh dirinya atau melakukan perbuatan yang membawa kepada kehancuran dan kebinasaan. Sedangkan orang yang mendonorkan salah satu organ tubuhnya secara tidak langsung telah melakukan perbuatan yang membawa kepada kehancuran dan kebinasaan. Padahal manusia tidak disuruh berbuat demikian, manusia hanya disuruh untuk menjaganya (organ tubuhnya) sesuai ayat di atas.Manusia tidak memiliki hak atas organ tubuhnya seluruhnya,karena pemilik organ tubuh manusia Adalah Allah swt.Pendapat 2: Hukumnya jaiz (boleh) namun memiliki syarat-syarat tertentu.Dalil 2: Seseorang yang mendonorkan organ tubuhnya kepada orang lain untuk menyelamatkan hidupnya merupakan perbuatan saling tolong-menolong atas kebaikan sesuai firman Allah swt Dan saling tolong menolonglah kamu dalam kebaikan dan taqwa dan janganlah kamu saling tolong monolong dalam perbuatan dosa dan permusuhan (Qs.Al-maidah 2).Setiap insan, meskipun bukan pemilik tubuhnya secara pribadi namun memiliki kehendak atas apa saja yang bersangkutan dengan tubuhnya, ditambah lagi bahwa Allah telah memberikan kepada manusia hak untuk mengambil manfaat dari tubuhnya, selama tidak membawa kepada kehancuran, kebinasaan dan kematian dirinya (QS. An-Nisa 29 dan al-Baqarah 95). Oleh karena itu, sesungguhnya memindahkan organ tubuh ketika darurat merupakan pekerjaan yang mubah (boleh) dengan dalilTransplantasi organ ketika dalam keadaan komaPendapat: Melakukan transplantasi organ tubuh donor dalam keadaan masih hidup, meskipun dalam keadaan koma, hukumnyaharam.Dalil: Sesungguhnya perbuatan mengambil salah satu organ tubuh manusia dapat membawa kepada kemudlaratan, sedangkan perbuatan yang membawa kepada kemudlaratan merupakan perbuatan yang terlarang sesuai Hadist nabi Muhammad saw Tidak boleh melakukan pekerjaan yang membawa kemudlaratan dan tidak boleh ada kemudlaratanManusia wajib berusaha untuk menyembuhkan penyakitnya dem mempertahankan hidupnya, karena hidup dan mati itu berada ditangan Allah SWT. Oleh sebab itu, manusia tidak boleh mencabut nyawanya sendiri atau mempercepat kematianorang lain, meskipun mengurangi atau menghilangkan penderitaan pasien.

Transplantasi organ ketika dalam keadaan telah meninggalPendapat 1: Hukumnya Haram karena kesucian tubuh manusia setiap bentuk agresi atas tubuh manusia merupakan hal yang terlarang.Dalil: Ada beberapa perintah Al-Quran dan Hadist yang melarang. Diantara hadist yang terkenal, yaitu:Mematahkan tulang mayat seseorang sama berdosanya dan melanggarnya dengan mematahkan tulang orang tersebut ketika ia masih hidupTubuh manusia adalah amanah, pada dasarnya bukanlah milik manusia tapi merupakan amanah dari Allah yang harus dijaga, karena itu manusia tidak memiliki hak untuk mendonorkannya kepada orang lain.

Pendapat 2: Hukumnya Boleh.Dalil: Dalam kaidah fiqiyah menjelaskan bahwa Apabila bertemu dua hal yang mendatangkan mafsadah (kebinasaan), maka dipertahankan yang mendatangkan madharat yang paling besar dengan melakukan perbuatan yang paling ringan madharatnya dari dua madharat.Selama dalam pekerjaan transplantasi itu tidak ada unsur merusak tubuh mayat sebagai penghinaan kepadanya.Alasan Dasar Pandangan-Pandangan Transplantasi OrganSebagaimana halnya dalam kasus-kasus lain, karena karakter fikih dalam Islam, pendapat yang muncul tak hanya satu tapi beragam dan satu dengan lainnya, bahkan ada yang saling bertolak belakang, meski menggunakan sumber-sumber yang sama. Dalam pembahasan ini akan disampaikan beberapa pandangan yang cukup terkenal, dan alasan-alasan yang mendukung dan menentang transplantasi organ, menurut aziz dalam beranda, yaitu:Pandangan yang menentang pencangkokan organ.Ada tiga alasan yang mendasar, yaitu:a) Kesucian hidup/tubuh manusiaSetiap bentuk agresi terhadap tubuh manusia dilarang, karena ada beberapa perintah yang jelas mengenai ini dalam Al-Quran. Dalam kaitan ini ada satu hadis (ucapan) Nabi Muhammad yang terkenal yang sering dikutip untuk menunjukkan dilarangnya manipulasi atas tubuh manusia, meskipun sudah menjadi mayat, Mematahkan tulang mayat seseorang adalah sama berdosa dan melanggarnya dengan mematahkan tulang orang itu ketika ia masih hidupb) Tubuh manusia adalah amanahHidup dan tubuh manusia pada dasarnya adalah bukan miliknya sendiri, tapi pinjaman dari Tuhan dengan syarat untuk dijaga, karena itu manusia tidak boleh untuk merusak pinjaman yang diberikan oleh Allah SWT.c) Tubuh tak boleh diperlakukan sebagai benda material semataPencangkokan dilakukan dengan mengerat organ tubuh seseorang untuk dicangkokkan pada tubuh orang lain, disini tubuh dianggap sebagai benda material semata yang bagian-bagiannya bisa dipindah-pindah tanpa mengurangi ketubuh seseorang.Pandangan yang mendukung pencangkokan organAda beberapa dasar, antara lain:a) Kesejahteraan publik (maslahah)Pada dasarnya manipulasi organ memang tak diperkenankan, meski demikian ada beberapa pertimbangan lain yang bisa mengalahkan larangan itu, yaitu potensinya untuk menyelamatkan hidup manusia yang mendapat bobot amat tinggi dalam hukum Islam. Dengan alasan ini pun, ada beberapa kualifikasi yang mesti diperhatikan, yaitu (1) Pencangkokan organ boleh dilakukan jika tak ada alternatif lain untuk menyelamatkan nyawa, (2) derajat keberhasilannya cukup tinggi ada persetujuan dari pemilik organ asli (atau ahli warisnya), (3) penerima organ sudah tahu persis segala implikasi pencangkokan ( informed consent )b) AltruismeAda kewajiban yang amat kuat bagi muslim untuk membantu manusia lain khususnya sesama muslim, pendonoran organ secara sukarela merupakan bentuk altruisme yang amat tinggi (tentu ini dengan anggapan bahwa si donor tak menerima uang untuk tindakannya), dan karenanya dianjurkan

24