My Little Diary_ Laporan Praktikum Biokimia Enzim

download My Little Diary_ Laporan Praktikum Biokimia Enzim

of 17

  • date post

    18-Feb-2016
  • Category

    Documents

  • view

    21
  • download

    2

Embed Size (px)

description

laporan biokimia

Transcript of My Little Diary_ Laporan Praktikum Biokimia Enzim

  • MylittleDiary

    Minggu,02November2014

    laporanpraktikumbiokimiaenzim

    I.Judul:UjiEnzim

    II.Tujuan:Kegiatan1:untukmengetahuipengaruhsuhuterhadapaktivitasenzim.Kegiatan2:untukmembuktikanbahwaderajatkeasaman(pH)mempengaruhiaktivitas

    enzim.Kegiatan3:untukmengetahuipengaruhkonsentrasienzimterhadapperombakansuatu

    substrat(amilum).Kegiatan4:untukmengetahuipengaruhkonsentrasisubstratterhadapaktivitasenzim.Kegiatan5:untukmembuktikanadanyapigmenpigmendalamempedu.Kegiatan6:untukmembuktikanadanyaasamempedudalamlarutanempedu.

    III.LandasanTeoriEnzim adalah golongan protein yang paling banyak terdapat dalam sel hidup.

    Sekarang,kirakiralebihdari2.000enzimtelahteridentifikasi,yangmasingmasingberfungsisebagai katalisator reaksi kimia dalam system hidup. Sintesis enzim terjadi didalam sel dansebagiannesarenzimdapatdiperolehdariekstraksidarijaringantanpamerusakfungsinya.

    Sebagai katalisator, enzim berbeda dengan katalisator anorganik dan organicsederhana yang umumnya dapat mengkatalisis berbagai reaksi kimia. Enzim memepunyaispesifitas yang sangat tinggi, baik terhadap reaktan (substrat) maupun jenis reaksi yangdikatalisiskan.Padaumumnya,suatuenzimhanyamengkatalisissatujenisreaksidanbekerjapadasuatusubstrattertentu.Kemudian,enzimdapatmeningkatkanlajureaksiyangluarbiasatanpapembentukanproduksampingdanmolekulberfungsidalamlarutanencerpadakeadaanbiasa (fisiologis) tekanan, suhu, dan pH normal. Hanya sedikit katalisator nonbiologi yangdilengkapisifatsifatdemikian.

    Enzimmerupakanunit fungsionaldarimetabolismsel.Enzimbekerjadenganurutanurutanyangteraturdanmengkatalisisratusanreaksidarireaksiyangsangatsederhansepertireplikasikromosomsampaikereaksiyangsangatrumit,misalnyayangmenguraikanmolekulnutrient, menyimpan dan mengubah energy kimiawi. Masingmasing reaksi dikatalisis olehsejenisenzimtertentu.Diantarasejumlahenzimtesebut,adasekelompokenzimyangdisebutenzim pengatur. Enzim dapat mengenali berbagai isyarat metabolis yang diterima. Melaluiaktivitasnya, enzim pengatur mengkoordinasikan system enzim dengan baik, sehinggamenghasilkan hubungan harmonis diantara sejumlah aktivitasmetabolis yang berbeda. Padakeadaanabnormalatauaktivitasberlebihansuatuenzimdapatmenimbulkanpenyakit.

    Semua enzim pada hakikatnya adalah protein. Beberapa diantaranya mempunyaistruktur agak sederhana sedangkan sebagian besar lainnya memiliki struktur rumit. Naun,kebanyakanenzimbaruberfungsisebagaikatalisapabiladisertaizatlainyangbukanprotein,

    yangdisebutkofaktor.Suatukofaktordapatberupa ion logamsederhana sepertiFe2+ atau

    Cu2, tetapi dapat pula berupa molekul organic kompleks yang disebut koenzim. Bagianproteindarienzimdisebutapoenzim.Kemudiangabunganapoenzimdankofaktornyasehinggaenzimmenjadaktifdisebutholoenzim.

    Berdasarkanjenisreaksiyangdikatalisis,enzimdapatdibagimenjadienamgolonganutamayaitu:

    riskiangestiIkuti 2

    Lihatprofillengkapku

    MengenaiSaya

    2014(8)November(6)

    aboutOrioluschinensis

    ujisensitivasantibiotikaterhadapmikrobalapora...

    laporanpraktikumbiokimiaenzim

    laporanpraktikumbiokimiaprotein

    laporanpraktikumbiokimiaujilipid

    laporanpraktikumbiokimiakarbohidrat

    Februari(2)

    ArsipBlog

    1 Lainnya BlogBerikut waone.wibisono@gmail.com Dasbor Keluar

  • 1.Oksidoreduktase:kelompokenzimyangmengerjakanreaksioksidasidanreduksi.2.Transferase:kelompokenzimyangberperandalamreaksipemindahansuatugugus

    darisuatusenyawakepadasenyawalain.3.Hidrolase:kelompokenzimyangberperandalamreaksihidrolisis.4. Liase: kelompok enzimyangmengkatalisis reaksi adisi atau pemecahan ikatan

    rangkap.5. Isomerase:kelompokenzimyangmengkatalisisperubahankonformasimolekul

    (isomerisasi).6. Ligase (sintetase): kelompok enzim yang mengkatalisis pembentukan ikatan

    kovalen.Banyakfactoryangmempengaruhiaktivitasenzim.Beberapadiantaranyayangpaling

    pentingadalahsuhu,pH,konsentrasienzim,dankonsentrasisubstrat.a.Pengaruhsuhu

    Setiapenzimmempunyaisuhuoptimum,yaitusuhudimanaenzimmemilikiaktivitasmaksimal.Enzimdidalamtubuhmanusiamempunyaisuhuoptimalsekitar37C.dibawahataudiatassuhuoptimum,aktivitasenzimmenurun.Suhumendekati titikbeku tidak merusak enzim, tetapi enzim tidak aktif. Jika suhu dinaikkan, makaaktivitas enzim meningkat. Namun, kenaikan enzim yang cukup besar dapatmenyebabkan enzim mengalami denaturasi dan mematikan aktivitas katalisnya.Sebaianenzimmengalamidenaturasipadasuhudiatas60C.

    b.PengaruhpHEnzim bekerja pada pH tertentu, umumnya pada pH sekitar 68. Setiap enzimmempuntaipHoptimumyangkhas.pHoptimumenzimumumnyaadalah sekitarpH jaringandimanaenzimberada.BeberapaenzimadayangaktivitasnyapadapHtinggidanadapulayangpadapHrendah.Misalnya,pepsinmerupakanenzimpencernaanyang terdapatdalamusushalusdanmemilikipH7,7.PadapH jauhdiataspHoptimum,enzimakanmengalamidenaturasi.

    c.PengaruhkonsentrasienzimPada konsentrasi substrat tertentu, bertambahnya konsentrasi enzim akanmeningkatkankecepatanreaksienzimatis(V)berbandinglurusdengankonsentrasienzim(E)sampaibatastertentu,sehinggareaksimengalamikesetimbangan.Padasaatsetimbang,peningkatanknsentrasienzimsudahtidakberpengaruh.

    d.Pengaruhkonsentrasisubstrat

    Padakonsentrasienzimyangtetap,peningkatankonsentrasisubstratakanmenaikkankecepatanreaksienzimatissampaimencapaikecepatanmaksimumyangtetap.Padatitikmaksimumsemuaenzimtelahjenuhdengansubstrat,sehinggapenambahansubstratsudahtidakakanmeningkatkankecepatanreaksienzimatis.

    Gambar1.KurvapengaruhkonsentrasisubstratterhadapaktivitasenzimEnzim,sepertiproteinlain,mempunyaiberatmolekulyangberkisardarikira

    kira 12.000 sampai lebih dari 1 juta.Oleh karena itu, enzim berukuran amat besardibandingkandengansubstratataugugusfungsionaltargetnya.Beberapaenzimhanyaterdiridaripolipeptidadantidakmengandungguguskimiawiselainresiduasamamino.Akan tetapi enzim lain memerlukan tambahan komponen kimia bagi aktivitasnyakomponeninidisebutkofaktor.Kofaktormungkinsuatumolekulanorganiksepertiion

    Fe2+,Mn2+ atau Zn2+ atau mungkin juga suatu molekul anorganik kompleks yangdisebutkoenzim.Beberapaenzimmembutuhkanbaikkoenzimmaupunsatuataulebihion logam bagi aktivitasnya. Pada beberapa enzim, koenzim atau ion logam hanya

  • terikatsecaralemahataudalamwaktusementarapadaprotein,tetapipadaenzimlainsenyawainiterikatkuat,atauterikatsecarapermanenyangdalamhalinidisebutgugusprostetik. Enzim yang strukturnya sempurna dan aktif mengkatalisis, bersamasamadengan koenzim atau gugus logamnya disebut holoenzim. Koenzim dan ion logambersifatstabilsewaktupemanasan,sedangkanbagianproteinenzimakanterdenaturasiolehpemanasan(Lehninger,1982).

    Pada suhu sangat rendah, aktivitas enzim dapat terhenti secara reversible.Kenaikan suhu lingkungan akan meningkatkan energi kinetik enzim dan frekuensitumbukanantaramolekulenzimdansubstrat,sehinggaenzimmenjadiaktif.Padasuhu

    dimana enzimmasih aktif, umumnyakenaikan suhu10oCmenyebabkan kecepatanreaksi enzimatis bertambah 1,1 hingga 3,0 kali lebih besar. Pada suhu optimum,kecepatanreaksienzimatisberlangsungmaksimal.Bilasuhuterusditingkatkan,makaenzim akan mengalami denaturasi, sehingga aktivitas katalitiknya terhenti. Sebagian

    besarenzimmemilikisuhuoptimum30oCs.d.40oCdanmengalamidenaturasisecara

    irreversiblepadapemanasandiatassuhu60oC(Yazid,2006).EnzimbekerjapadakisaranpHtertentu.JikadilakukanpengukuranaktivitasenzimpadabeberapamacampHyangberlainan,sebagianbesarenzimdidalamtubuhakanmenunjukkanaktivitasmaksimum antara pH 5,0 sampai 9,0. Kecepatan reaksi enzimatik mencapaipuncaknyapadapHoptimum.AdaenzimyangmempunyaipHoptimumyangsangatrendah,sepertipepsin,yangmempunyaipHoptimum2.PadapHyangjauhdiluarpHoptimum, enzim akan terdenaturasi. Selain itu pada keaadan ini baik enzimmaupunsubstrat dapatmengalami perubahanmuatan listrik yangmengakibatkan enzim tidakdapat berikatan dengan substrat. Enzim bekerja pada kisaran pH tertentu danumumnyatergantungpadapHlingkungannya.EnzimmenunjukkanaktivitasmaksimalpadapHoptimum,umumnyaantarapH6 s.d. 8,0. JikapH lebih rendahatau lebihtinggidaripadapHoptimum,makadapatmenyebabkanenzimmengalamidenaturasisehinggamenurunkanaktivitasnya.

    Terjadinyapenurunanaktivitasenzimdapatdilihatdarihasilhidrolisissubstratyang dikatalisis.Misalnya, amilum terhidrolisisi menjadi maltosa atau glukosa. HasilhidrolisisdapatdibuktikandenganujiBenedict.Bilapositif,berartiamilumterhidrolisis,sehingga dapat diasumsikan enzimmemiliki aktivitas tinggi. Sebaliknya, bila hasilnyanegatif, berarti amilum tidak terhidrolisis karena enzim tidak aktif atau mengalamipenurunanaktivitas(Yazid,2006).Pada konsentrasi substrat tertentu, bertambahnya konsentrasi enzim ecara singkat

    akanmenaikkan kecepatan reaksi enzimatis. Dengan kata lain, semakin besar volume ataukonsentrasienzim,semakintinggipulaaktivitasenzimdalammemecahsubstratyangdikatalis.Halinidapatdilihatdariperbedaanwarnayangterjadimelaluiujiiodiumatauadanyaendapanyangterbentukmelaluiujibenedict.

    Padakonsentrasienzimyangtetappenambahankonsentrasisubstratakanmenaikkankecepatan reaksienzimatis sampaimencapaikecepatanmaksimumyang tepat.Penambahansubstrat setelah kecepatan maksimum tidak berpengaruh lagi, sebab telah melampaui titikjenuh.

    Empedumengandungbermacammacampigmen.Pigmenempeduyangutamaadalahbiliverdinyangberwarnahijaudanbilirubinyangberwarnajinggaataukuningcoklat.Oksidasipigmenpigmen empedu oleh oksidator kuat seperti HNO3 akan menghasilkan turunan

    senyawayangberwarna.Misalnya:Messobiliverdin:hijaubiruMesobirubin:kuningMesobilisianin:biruunguatauviolet

    Didalamempedu,asamasamempedu,sepertiasamkholatdanasamkenodeokikolatterutamasebagaigaramnya,merupakanturunansenyawaaromatickompleks.Asamempedudenganfurfural(dihasilkandaridehidrasikarbohidratolehH2SO4pekat)akanberkondensasi

    membentuksenyawaberwarna(Yazid,2006).

    IV.AlatdanBahan4.1Kegiatan1:PengaruhSuhuTerhadap4.2Kegiatan2:PengaruhpHTerhadap

    AktivitasEnzimAktivitasEnzim4.1.1Alat:4.2.1Alat:

    1.A