My Little Diary_ Laporan Praktikum Biokimia Enzim

Click here to load reader

  • date post

    18-Feb-2016
  • Category

    Documents

  • view

    36
  • download

    5

Embed Size (px)

description

laporan biokimia

Transcript of My Little Diary_ Laporan Praktikum Biokimia Enzim

  • MylittleDiary

    Minggu,02November2014

    laporanpraktikumbiokimiaenzim

    I.Judul:UjiEnzim

    II.Tujuan:Kegiatan1:untukmengetahuipengaruhsuhuterhadapaktivitasenzim.Kegiatan2:untukmembuktikanbahwaderajatkeasaman(pH)mempengaruhiaktivitas

    enzim.Kegiatan3:untukmengetahuipengaruhkonsentrasienzimterhadapperombakansuatu

    substrat(amilum).Kegiatan4:untukmengetahuipengaruhkonsentrasisubstratterhadapaktivitasenzim.Kegiatan5:untukmembuktikanadanyapigmenpigmendalamempedu.Kegiatan6:untukmembuktikanadanyaasamempedudalamlarutanempedu.

    III.LandasanTeoriEnzim adalah golongan protein yang paling banyak terdapat dalam sel hidup.

    Sekarang,kirakiralebihdari2.000enzimtelahteridentifikasi,yangmasingmasingberfungsisebagai katalisator reaksi kimia dalam system hidup. Sintesis enzim terjadi didalam sel dansebagiannesarenzimdapatdiperolehdariekstraksidarijaringantanpamerusakfungsinya.

    Sebagai katalisator, enzim berbeda dengan katalisator anorganik dan organicsederhana yang umumnya dapat mengkatalisis berbagai reaksi kimia. Enzim memepunyaispesifitas yang sangat tinggi, baik terhadap reaktan (substrat) maupun jenis reaksi yangdikatalisiskan.Padaumumnya,suatuenzimhanyamengkatalisissatujenisreaksidanbekerjapadasuatusubstrattertentu.Kemudian,enzimdapatmeningkatkanlajureaksiyangluarbiasatanpapembentukanproduksampingdanmolekulberfungsidalamlarutanencerpadakeadaanbiasa (fisiologis) tekanan, suhu, dan pH normal. Hanya sedikit katalisator nonbiologi yangdilengkapisifatsifatdemikian.

    Enzimmerupakanunit fungsionaldarimetabolismsel.Enzimbekerjadenganurutanurutanyangteraturdanmengkatalisisratusanreaksidarireaksiyangsangatsederhansepertireplikasikromosomsampaikereaksiyangsangatrumit,misalnyayangmenguraikanmolekulnutrient, menyimpan dan mengubah energy kimiawi. Masingmasing reaksi dikatalisis olehsejenisenzimtertentu.Diantarasejumlahenzimtesebut,adasekelompokenzimyangdisebutenzim pengatur. Enzim dapat mengenali berbagai isyarat metabolis yang diterima. Melaluiaktivitasnya, enzim pengatur mengkoordinasikan system enzim dengan baik, sehinggamenghasilkan hubungan harmonis diantara sejumlah aktivitasmetabolis yang berbeda. Padakeadaanabnormalatauaktivitasberlebihansuatuenzimdapatmenimbulkanpenyakit.

    Semua enzim pada hakikatnya adalah protein. Beberapa diantaranya mempunyaistruktur agak sederhana sedangkan sebagian besar lainnya memiliki struktur rumit. Naun,kebanyakanenzimbaruberfungsisebagaikatalisapabiladisertaizatlainyangbukanprotein,

    yangdisebutkofaktor.Suatukofaktordapatberupa ion logamsederhana sepertiFe2+ atau

    Cu2, tetapi dapat pula berupa molekul organic kompleks yang disebut koenzim. Bagianproteindarienzimdisebutapoenzim.Kemudiangabunganapoenzimdankofaktornyasehinggaenzimmenjadaktifdisebutholoenzim.

    Berdasarkanjenisreaksiyangdikatalisis,enzimdapatdibagimenjadienamgolonganutamayaitu:

    riskiangestiIkuti 2

    Lihatprofillengkapku

    MengenaiSaya

    2014(8)November(6)

    aboutOrioluschinensis

    ujisensitivasantibiotikaterhadapmikrobalapora...

    laporanpraktikumbiokimiaenzim

    laporanpraktikumbiokimiaprotein

    laporanpraktikumbiokimiaujilipid

    laporanpraktikumbiokimiakarbohidrat

    Februari(2)

    ArsipBlog

    1 Lainnya BlogBerikut [email protected] Dasbor Keluar

  • 1.Oksidoreduktase:kelompokenzimyangmengerjakanreaksioksidasidanreduksi.2.Transferase:kelompokenzimyangberperandalamreaksipemindahansuatugugus

    darisuatusenyawakepadasenyawalain.3.Hidrolase:kelompokenzimyangberperandalamreaksihidrolisis.4. Liase: kelompok enzimyangmengkatalisis reaksi adisi atau pemecahan ikatan

    rangkap.5. Isomerase:kelompokenzimyangmengkatalisisperubahankonformasimolekul

    (isomerisasi).6. Ligase (sintetase): kelompok enzim yang mengkatalisis pembentukan ikatan

    kovalen.Banyakfactoryangmempengaruhiaktivitasenzim.Beberapadiantaranyayangpaling

    pentingadalahsuhu,pH,konsentrasienzim,dankonsentrasisubstrat.a.Pengaruhsuhu

    Setiapenzimmempunyaisuhuoptimum,yaitusuhudimanaenzimmemilikiaktivitasmaksimal.Enzimdidalamtubuhmanusiamempunyaisuhuoptimalsekitar37C.dibawahataudiatassuhuoptimum,aktivitasenzimmenurun.Suhumendekati titikbeku tidak merusak enzim, tetapi enzim tidak aktif. Jika suhu dinaikkan, makaaktivitas enzim meningkat. Namun, kenaikan enzim yang cukup besar dapatmenyebabkan enzim mengalami denaturasi dan mematikan aktivitas katalisnya.Sebaianenzimmengalamidenaturasipadasuhudiatas60C.

    b.PengaruhpHEnzim bekerja pada pH tertentu, umumnya pada pH sekitar 68. Setiap enzimmempuntaipHoptimumyangkhas.pHoptimumenzimumumnyaadalah sekitarpH jaringandimanaenzimberada.BeberapaenzimadayangaktivitasnyapadapHtinggidanadapulayangpadapHrendah.Misalnya,pepsinmerupakanenzimpencernaanyang terdapatdalamusushalusdanmemilikipH7,7.PadapH jauhdiataspHoptimum,enzimakanmengalamidenaturasi.

    c.PengaruhkonsentrasienzimPada konsentrasi substrat tertentu, bertambahnya konsentrasi enzim akanmeningkatkankecepatanreaksienzimatis(V)berbandinglurusdengankonsentrasienzim(E)sampaibatastertentu,sehinggareaksimengalamikesetimbangan.Padasaatsetimbang,peningkatanknsentrasienzimsudahtidakberpengaruh.

    d.Pengaruhkonsentrasisubstrat

    Padakonsentrasienzimyangtetap,peningkatankonsentrasisubstratakanmenaikkankecepatanreaksienzimatissampaimencapaikecepatanmaksimumyangtetap.Padatitikmaksimumsemuaenzimtelahjenuhdengansubstrat,sehinggapenambahansubstratsudahtidakakanmeningkatkankecepatanreaksienzimatis.

    Gambar1.KurvapengaruhkonsentrasisubstratterhadapaktivitasenzimEnzim,sepertiproteinlain,mempunyaiberatmolekulyangberkisardarikira

    kira 12.000 sampai lebih dari 1 juta.Oleh karena itu, enzim berukuran amat besardibandingkandengansubstratataugugusfungsionaltargetnya.Beberapaenzimhanyaterdiridaripolipeptidadantidakmengandungguguskimiawiselainresiduasamamino.Akan tetapi enzim lain memerlukan tambahan komponen kimia bagi aktivitasnyakomponeninidisebutkofaktor.Kofaktormungkinsuatumolekulanorganiksepertiion

    Fe2+,Mn2+ atau Zn2+ atau mungkin juga suatu molekul anorganik kompleks yangdisebutkoenzim.Beberapaenzimmembutuhkanbaikkoenzimmaupunsatuataulebihion logam bagi aktivitasnya. Pada beberapa enzim, koenzim atau ion logam hanya

  • terikatsecaralemahataudalamwaktusementarapadaprotein,tetapipadaenzimlainsenyawainiterikatkuat,atauterikatsecarapermanenyangdalamhalinidisebutgugusprostetik. Enzim yang strukturnya sempurna dan aktif mengkatalisis, bersamasamadengan koenzim atau gugus logamnya disebut holoenzim. Koenzim dan ion logambersifatstabilsewaktupemanasan,sedangkanbagianproteinenzimakanterdenaturasiolehpemanasan(Lehninger,1982).

    Pada suhu sangat rendah, aktivitas enzim dapat terhenti secara reversible.Kenaikan suhu lingkungan akan meningkatkan energi kinetik enzim dan frekuensitumbukanantaramolekulenzimdansubstrat,sehinggaenzimmenjadiaktif.Padasuhu

    dimana enzimmasih aktif, umumnyakenaikan suhu10oCmenyebabkan kecepatanreaksi enzimatis bertambah 1,1 hingga 3,0 kali lebih besar. Pada suhu optimum,kecepatanreaksienzimatisberlangsungmaksimal.Bilasuhuterusditingkatkan,makaenzim akan mengalami denaturasi, sehingga aktivitas katalitiknya terhenti. Sebagian

    besarenzimmemilikisuhuoptimum30oCs.d.40oCdanmengalamidenaturasisecara

    irreversiblepadapemanasandiatassuhu60oC(Yazid,2006).EnzimbekerjapadakisaranpHtertentu.JikadilakukanpengukuranaktivitasenzimpadabeberapamacampHyangberlainan,sebagianbesarenzimdidalamtubuhakanmenunjukkanaktivitasmaksimum antara pH 5,0 sampai 9,0. Kecepatan reaksi enzimatik mencapaipuncaknyapadapHoptimum.AdaenzimyangmempunyaipHoptimumyangsangatrendah,sepertipepsin,yangmempunyaipHoptimum2.PadapHyangjauhdiluarpHoptimum, enzim akan terdenaturasi. Selain itu pada keaadan ini baik enzimmaupunsubstrat dapatmengalami perubahanmuatan listrik yangmengakibatkan enzim tidakdapat berikatan dengan substrat. Enzim bekerja pada kisaran pH tertentu danumumnyatergantungpadapHlingkungannya.EnzimmenunjukkanaktivitasmaksimalpadapHoptimum,umumnyaantarapH6 s.d. 8,0. JikapH lebih rendahatau lebihtinggidaripadapHoptimum,makadapatmenyebabkanenzimmengalamidenaturasisehinggamenurunkanaktivitasnya.

    Terjadinyapenurunanaktivitasenzimdapatdilihatdarihasilhidrolisissubstratyang dikatalisis.Misalnya, amilum terhidrolisisi menjadi maltosa atau glukosa. HasilhidrolisisdapatdibuktikandenganujiBenedict.Bilapositif,berartiamilumterhidrolisis,sehingga dapat diasumsikan enzimmemiliki aktivitas tinggi. Sebaliknya, bila hasilnyanegatif, berarti amilum tidak terhidrolisis karena enzim tidak aktif atau mengalamipenurunanaktivitas(Yazid,2006).Pada konsentrasi substrat tertentu, bertambahnya konsentrasi enzim ecara singkat

    akanmenaikkan kecepatan reaksi enzimatis. Dengan kata lain, semakin besar volume ataukonsentrasienzim,semakintinggipulaaktivitasenzimdalammemecahsubstratyangdikatalis.Halinidapatdilihatdariperbedaanwarnayangterjadimelaluiujiiodiumatauadanyaendapanyangterbentukmelaluiujibenedict.

    Padakonsentrasienzimyangtetappenambahankonsentrasisubstratakanmenaikkankecepatan reaksienzimatis sampaimencapaikecepatanmaksimumyang tepat.Penambahansubstrat setelah kecepatan maksimum tidak berpengaruh lagi, sebab telah melampaui titikjenuh.

    Empedumengandungbermacammacampigmen.Pigmenempeduyangutamaadalahbiliverdinyangberwarnahijaudanbilirubinyangberwarnajinggaataukuningcoklat.Oksidasipigmenpigmen empedu oleh oksidator kuat seperti HNO3 akan menghasilkan turunan

    senyawayangberwarna.Misalnya:Messobiliverdin:hijaubiruMesobirubin:kuningMesobilisianin:biruunguatauviolet

    Didalamempedu,asamasamempedu,sepertiasamkholatdanasamkenodeokikolatterutamasebagaigaramnya,merupakanturunansenyawaaromatickompleks.Asamempedudenganfurfural(dihasilkandaridehidrasikarbohidratolehH2SO4pekat)akanberkondensasi

    membentuksenyawaberwarna(Yazid,2006).

    IV.AlatdanBahan4.1Kegiatan1:PengaruhSuhuTerhadap4.2Kegiatan2:PengaruhpHTerhadap

    AktivitasEnzimAktivitasEnzim4.1.1Alat:4.2.1Alat:

    1.Alatpemanas1.Tabungreaksi

  • 2.Tabungreaksi2.Pipetukur3.Gelaskimia3.Alatpemanas4.Pipetukur

    4.1.2Bahan:4.2.2Bahan:1.Larutanamilum2%1.Larutanamilum2%2.Enzimamylase(saliva)2.Enzimamilase3.Larutaniodium3.LarutanHCl0,4%,

    pH=14.Larutanbenedict4.Aquades,pH=7

    5.LarutanNa2CO31%,pH=9

    6.Larutaniodium7.Pereaksibenedict

    4.3Kegiatan3:PengaruhKonsentrasiEnzim4.4Kegiatan4:PengaruhKonsentrasiTerhadapAktivitasEnzimSubstratTerhadapAktivitasEnzim

    4.3.1Alat:4.4.1Alat:1.Alatpemanas1.Tabungreaksi2.Tabungreaksi2.Pipetukur3.Pipetukur4.Gelasbeker5.Pipettetes

    4.3.2Bahan:4.4.2Bahan:1.Larutanamilum2%1.Larutanamilum2%2.Enzimamilase2.Enzimamilase3.Larutaniodium3.Larutaniodium4.Pereaksibenedict4.Pereaksibenedict

    4.5Kegiatan5:UjiGmelin4.6Kegiatan6:UjiPettenkofer4.5.1Alat:4.6.1Alat:

    1.Tabungreaksi1.Tabungreaksi2.Pipettetes2.Pipettetes3.Gelasbeker3.Gelasbeker

    4.5.2Bahan:4.6.2Bahan:1.Larutanempedupekat(1:10)1.Larutanempedu

    pekat(1:10)

    2.LarutanHNO3pekat2.Larutansukrosa

    5%3.Larutaniodium3.LarutanH2SO4

    pekat

    V.LangkahKerja5.1PengaruhSuhuTerhadapAktivitasEnzim

    1.Menyediakan6tabungreaksiyangbersihdankering.2. Menambahkan1mlenzimamilase(saliva)padasetiaptabungdanmemberi

    labelsetiaptabungreaksi..3.Memasukkantabungreaksiberlabel1dan2kedalamgelaskimiayangberisi

    esbatu.4.Menyimpantabungreaksiberlabel3dan4padasuhukamar.5.Memasukkantabungreaksiberlabel5dan6kedalamgelaskimiayangberisi

    airmendidih.6.Membiarkanmasingmasingtabungpadatempatnyaselama5menit.7.Menambahkan2mlamilumpadamasingmasingtabungdanmenungguselama

    15menit.8.MelakukanujiIodium(1tetesreagent)padatabungreaksiberlabel1,3,dan

  • 5.9. MelakukanujiBenedict (4 tetesreagent)pada tabungreaksiberlabel2,4,

    dan6.10.Mencatatperubahanwarnayangterjadipadamasingmasinguji.

    5.2PengaruhpHTerhadapAktivitasEnzim1.Menyediakan6tabungreaksiyangbersih.2.Memberilabelsetiaptabungreaksi.3.Menambahkan2mllarutanHCl0,4%kedalamtabungreaksiberlabel1dan

    2.4.Menambahkan2mlaquadeskedalamtabungreaksiberlabel3dan4.5.Menambahkan2mllarutanNa2CO30,1%kedalamtabungreaksiberlabel5

    dan6. Menambahkan2ml amilumdan1ml enzimamilase (saliva)padamasing

    masingtabung.7.Mencampurkansampaihomogendanmenungguselama15menit.8.MelakukanujiIodium(1tetesreagent)padatabungreaksiberlabel1,3,dan

    5.9. MelakukanujiBenedict (4 tetesreagent)pada tabungreaksiberlabel2,4,

    dan6.10.Mencatatperubahanwarnayangterjadipadamasingmasinguji.

    5.3PengaruhKonsentrasiEnzimTerhadapAktivitasEnzim1.Menyediakan3tabungreaksiyangbersih,kemudianpadatabung1,2,dan3

    berturutturutdiisidenganenzimamylase:0,5ml1,0mldan1,5ml.2.Menambahkanlarutanamilum2mlkedalamtiaptabung.3.Mencampurdenganbaik,kemudianmembiarkanselama15menit.4. Menguji dengan larutan iodium sebanyak 1 tetes dan pereaksi benedict

    sebanyak4tetes.5.Mencatatdanmengematiperubahanyangterjadi.

    5.4PengaruhKonsentrasiSubstratTerhadapAktivitasEnzim1. Menyediakan 4 tabung reaksi yang bersih, kemudianmengisi berturutturut

    denganlarutanamilum:1ml,2ml,4ml,dan6ml.2.Menambahkanenzimamilase1mlkedalamtiaptabung.3.Mencampurdenganbaik,kemudianmembiarkanselama15menit.4. Menguji dengan larutan iodium sebanyak 1 tetes dan pereaksi benedict

    sebanyak4tetes.5.Mengamatidanmencatatperubahanyangterjadi.

    5.5UjiGmelin1. Menyediakan2 tabungreaksiyangbersih,kemudianmengisi tabungpertama

    dengan1mlHNO3pekatdantabungkeduadengan1mllarutaniodium0,5%..

    2. Melaluidinding tabungyangdimiringkan,menambahkansecarahatihati1mllarutanempedupadatiaptabung,sehinggakedualarutantidakbercampur.

    3.Memperhatikanterbetuknyawarnawarnapadaperbatasanantarakeduacairan.

    5.7UjiPettenkofer1. Memasukkan 1ml larutan empeduke dalam tabung reaksi yang bersih dan

    kering.2.Menambahkan2teteslarutansukrosa5%.3.Melaluidindingtabungyangdimiringkan,menambahkansecarahatihati10tetes

    H2SO4pekat,sehinggaterbentukdualapisancairan.

    4.Memperhatikanterbentuknyacincinwarnamerahvioletpadaperbatasanantarakedualapisan.

    VI.HasildanPembahasan6.1Hasil

    Kegiatan Gambar Keterangan

  • 1.PengaruhSuhuTerhadapAktivitasEnzim

    Pada tabung 1dan 2 diberi perlakuanditempatkan pada suhu

    0oC.Padatabung3dan4 diberi perlakuanditempatkan pada suhu

    25oC. Pada tabung 5dan 6 diberi perlakuanditempatkan pada suhu

    100oC.Tabung 1, 3, dan

    5 diuji Iodium. Tabung2, 4, dan 6 diujiBenedict.

    Tabung 1menghasilkanwarnabirutua, tabung 3menghasilkanwarnabirumuda, dan tabung 5menghasilkanwarnabirusangattua.

    Tabung 2 dan 6menghasilkanwarnabirumuda. Tabung 4menghasilkanwarnabirukehijauan.

    NomorTabung

    Suhu

    (oC)

    PerubahanWarna

    UjiIodium UjiBenedict

    1dan2 0 Birutua(+2) Birumuda3dan4 2530 Birumuda(+1) Birumendekatihijau5dan6 100 Birusangattua(+3) Biru

    Gb.SetelahditetesiIodium

    Gb.SetelahditetesiBenedict

  • 2.PengaruhpHTerhadapAktivitasEnzim

    Pada tabung1dan2 diberi perlakuanditempatkanpadapH=1.Padatabung3dan4diberi perlakuanditempatkanpadapH=7.Padatabung5dan6diberi perlakuanditempatkanpadapH=9.

    Tabung1,3,dan5diuji Iodium. Tabung 2,4,dan6diujiBenedict.

    Tabung 1menghasilkanwarnabirutua, tabung 3menghasilkanwarnabirumuda, dan tabung 5menghasilkan warnabening.

    Tabung2,4,dan6menghasilkanwarnabirumuda.

    NomorTabung

    pHPerubahanWarna

    UjiIodium UjiBenedict1dan4 1,0 Birutua Birumuda2dan5 7,0 Birumuda Birumuda3dan6 9,0 Bening Birumuda

    3.PengaruhKonsentrasiEnzimTerhadapAktivitasEnzim

    Pada uji benedict,ketiga tabung yangmasingmasing berisiamilase 0,5 ml, 1,0 ml,dan1,5mlmenghasilkanwarna biru muda.Sedangkan pada ujiiodium, tabung yangberisiamilase0,5mldan1,5 ml menghasilkanwarnabirutuadanpadatabung yang berisiamilase1,0 mlmenghasilkan warnacoklatpekat.

    Gb.Sebelumditetesiiodiumdanbenedict

    Gb.SetelahditetesiIodium

    Gb.SetelahditetesiBenedict

  • No. KonsentrasiSubstrat

    KonsentrasiEnzim

    PerubahanwarnaUjiIodium Uji

    Benedict1 Amilum2ml Amilase0,5ml Birutua Birumuda2 Amilum2ml Amilase1,0ml Coklat

    pekatBirumuda

    3 Amilum2ml Amilase1,5ml Birutua Birumuda

    4.PengaruhKonsentrasiSubstratTerhadapAktivitasEnzim

    Pada uji benedict

    tabung yang berisiamilum 1 ml dan 2 mlmenghasilkanwarnabirusedangkan pada tabungyang berisi amilum , 4ml, dan 6 mlmenghasilkanwarnabirubening.Padaujiiodium,tabung yang berisiamilum1ml,4ml,dan6ml menghasilkan warnabiru pekat, sedangkanpada tabungyangberisiamilum 2 ml tidakterbentuk warna(bening).

    Gb.Setelahditetesiiodiumdanbenedict

    Gb.Setelahdiujidenganiodium

    Gb.Setelahdiujidenganbenedict

    Ujibenedict Ujiiodium

  • No. KonsentrasiSubstrat

    KonsentrasiEnzim

    PerubahanwarnaUjiIodium UjiBenedict

    1 Amilum1ml Amilase1ml Birupekat Birukehijauan2 Amilum2ml Amilase1ml Bening Birukehijauan3 Amilum4ml Amilase1ml Birupekat Birubening4 Amilum6ml Amilase1ml Birupekat Birubening

    5.UjiGmelin

    Pada tabung 1yang berisi larutanempedu ditambahkandengan HNO3 pekat

    menghasilkan warnahijau kebiruan, ungu,kuning.Sedangkanpadatabung 2 yang berisilarutan empeduditambahkan larutaniodium 0,5%menghasilkan warnahijautua.

    Gb.Sebelumditambahkanempedu

    Gb.Setelahditambahkanempedu

  • Bahan Tabung1 Tabung2Larutanempedu 1ml 1mlLarutanHNO3pekat 1ml

    Larutaniodium0,5%

    1ml

    Hasil:perhatikanwarnayangterbentukantarakedualapisan

    Hijaukebiruan,ungu,kuning.

    Hijautua

    6. UjiPettenkofer

    Pada ujipettenkofer, setelahditambahkan H2SO4pekat positif terbentukcincin warna merahviolet

    Bahan Tabung1Larutanempedu 1mlLarutansukrosa5% 2tetesLarutanH2SO4pekat 10tetesHasil:cincinwarnamerahviolet(+/) +

    Gb.Sebelumditetesisukrosa

    Gb.Setelahditetesisukrosa

    Gb.SetelahditetesisukrosadanH2SO4

  • 6.2PembahasanBerdasarkanhasilpraktikumdiatasdiperolehpembahasanbahwapada

    percobaan pengaruh suhu terhadap aktivitas enzim, tabung reaksi yang berisiamilumdanenzimamilaseditempatkanpadasuhuyangberbedabeda.Dilakukanpula uji Iodium dan uji Benedict pada tabung reaksi seusai perlakuan. UjiIodiumbertujuanmembuktikanadanyapolisakarida,dalamhaliniadalahamilum.Identifikasi ini didasarkan pada pembentukan kompleks adsorpsi berwarnaspesifik oleh polisakarida akibat penambahan iodium. Reaksi amilum denganIodium menghasilkan berwarna biru kehitaman. UjiBenedict bertujuan membuktikan adanya gula reduksi (monosakarida maupunoligosakarida).Pengujian iniberdasarkan gulayangmempunyaigugusaldehida

    atauketonbebasmereduksiionCu2+dalamsuasanaalakalismenjadiCu+ yangmengendapsebagaiCu2Oberwarnamerahbata.Reaksipositifditandaidengan

    perubahan warna larutan menjadi hijau kekuningan, dan setelah dilakukanpemanasan terbentuk endapan berwarna merah bata, kepekatan warnasebanding dengan kandungan gula pereduksi yang ada (Yazid, 2006).Berdasarkan percobaan yang telah dilakukan, pada percobaan pengaruh suhuterhadap aktivitas enzim diperoleh hasil pengamatan bahwa pada pada tabung

    reaksiberlabel1yangdiberiperlakuanditempatkanpadasuhuesbatu (0oC)setelahdilakukanujiIodiumdidapatkanperubahanwarnalarutanmenjadibirutuadan diberi notasi +2, hal ini menunjukkan bahwa terdapatnya kandunganpolisakarida yang banyak. Pada tabung reaksi berlabel 2 yang juga diberi

    perlakuanditempatkanpadasuhuesbatu(0oC),setelahdilakukanujiBenedictdidapatkan perubahan warna larutan menjadi biru muda, hal ini menunjukkanbahwaterdapatnyasedikitkandunganmonosakaridamaupunoligosakarida.Padapada tabung reaksi berlabel 3 dan 4 diberi perlakuan ditempatkan pada suhu

    ruangan(2530oC).SetelahdilakukanujiIodiumpadatabungreaksiberlabel3,didapatkan perubahanwarna larutanmenjadi biru dan diberi notasi +1, hal inimenunjukkan bahwa terdapatnya sedikit kandungan polisakarida. Pada tabungreaksi berlabel 4, setelah dilakukan uji Benedict didapatkan perubahan warnalarutanmenjadi birukehijauan, hal inimenunjukkanbahwa terdapatnyabanyakkandungan monosakarida maupun oligosakarida. Pada pada tabung reaksi

    berlabel5dan6diberiperlakuanditempatkanpadasuhuairmendidih(100oC).Setelah dilakukan uji Iodium pada tabung reaksi berlabel 5, didapatkanperubahan warna larutan menjadi biru sangat tua dan diberi notasi +3, hal inimenunjukkanbahwaterdapatkandunganpolisakaridayangsangatbanyak.Padatabung reaksi berlabel 6, setelah dilakukan uji Benedict didapatkan perubahanwarna larutanmenjadi biru, hal inimenunjukkan bahwa terdapat sangat sedikitkandungan monosakarida maupun oligosakarida. Sangat disayangkan bahwapada uji Benedict yang dilakukan tidak disertai dengan pemanasan sehinggakandungan monosakarida maupun oligosakarida secara kuantitatif tidak dapatterlihatdenganjelas.Darihasilpengamatandidapatkanpembahasanbahwapada

    tabung reaksi yang diberi perlakuan ditempatkan pada suhu es batu (0oC),mengandung banyak polisakarida dan sedikit monosakarida ataupunoligosakarida.Hal ini dikarenakan enzimdalamkeadaan inaktif sehingga hanyasedikitterjadiataupunbahkantidakterjadireaksienzimatisantaraenzimamilasedengan amilum. Pada tabung yang diberi perlakuan ditempatkan pada suhu

    ruangan(2530oC),mengandung sedikitpolisakaridadan sedikitmonosakaridaataupun oligosakarida. Hal ini dikarenakan terjadi reaksi hidrolisis amilum(polisakarida) menjadi oligosakarida maupun monosakarida dengan bantuanenzimamilase.Padatabungreaksiyangdiberiperlakuanditempatkanpadasuhu

    air mendidih (100oC) mengandung polisakarida yang sangat banyak dankandungan monosakarida maupun oligosakarida yang sangat sedikit. Hal inidisebabkankarenapadasuhu tersebut,strukturproteindalamenzimmengalamidenaturasi dan kehilangan sifat enzimatisnya sehingga reaksi hidrolisis amilumterjadi sangat sedikit ataupun bahkan tidak terjadi sama sekali. Pengaruh suhu

  • terhadap aktivitas enzim amilase dapat dituliskan sebagai berikut. Pada suhu

    rendah (0oC) sifat katalis enzim menjadi inaktif, sedangkan pada suhu tinggi

    (100oC) enzimmenjadi terdenaturasi sehingga kehilangan fungsi enzimatisnya.

    Pada suhu kamar (2530oC) terjadi aktivitas enzimatis yang cukup optimal.Rentang suhu optimum enzim amilase belum bisa ditentukan. Rentang suhuoptimal suatu enzim tidak dapat dilakukan hanya dengan perlakuan pada saturentangsuhunonekstrimsaja,melainkanpadaberbagairentangsuhu.

    Pada percobaan pengaruh pH terhadap aktivitas enzim, tabung reaksiyangberisiamilumdanenzimamilaseditempatkanpadapHyangberbedabeda.DilakukanpulaujiIodiumdanujiBenedictpadatabungreaksiseusaiperlakuan(Yazid, 2006).Berdasarkan percobaan yang telah dilakukan, pada percobaanpengaruh pH terhadap aktivitas enzim diperoleh hasil pengamatan bahwa padapadatabungreaksiberlabel1dan2yangdiberiperlakuanditempatkanpadapHLarutan HCl 0,4% (pH=1). Setelah dilakukan uji Iodium pada tabung reaksiberlabel 1, didapatkan perubahan warna larutan menjadi biru tua, hal inimenunjukkanbahwaterdapatnyakandunganpolisakarida(dalamhaliniamilum)yang banyak. Pada tabung reaksi berlabel 2, setelah dilakukan uji Benedictdidapatkan perubahan warna larutan menjadi biru muda, hal ini menunjukkanbahwaterdapatnyasedikitkandunganmonosakaridamaupunoligosakarida.Padapada tabung reaksi berlabel 3 dan 4 diberi perlakuan ditempatkan pada pHaquades (pH=7). Setelah dilakukan uji Iodium pada tabung reaksi berlabel 3,didapatkan perubahan warna larutan menjadi biru muda, hal ini menunjukkanbahwaterdapatnyasedikitkandunganpolisakarida.Padatabungreaksiberlabel4, setelah dilakukan uji Benedict didapatkan perubahanwarna larutanmenjadibiru muda, hal ini menunjukkan bahwa terdapatnya sedikit kandunganmonosakaridamaupunoligosakarida.Padapadatabungreaksiberlabel5dan6diberiperlakuanditempatkanpadapHLarutanNa2CO30,1%(pH=9).Setelah

    dilakukanujiIodiumpadatabungreaksiberlabel5,didapatkanperubahanwarnalarutan menjadi bening, hal ini menunjukkan bahwa tidak terdapat kandunganpolisakarida. Pada tabung reaksi berlabel 6, setelah dilakukan uji Benedictdidapatkan perubahan warna larutan menjadi biru muda, hal ini menunjukkanbahwaterdapatsedikitkandunganmonosakaridamaupunoligosakarida.Sangatdisayangkan bahwa pada uji Benedict yang dilakukan tidak disertai denganpemanasan sehingga kandungan monosakarida maupun oligosakarida secarakuantitatiftidakdapatteramatidenganjelas.Berdasarkanreferensiyangdidapat,diketahui bahwa rentang pH optimum enzim amilase (ptialin) menyesuaikandengan pH rongga mulut yaitu antara 7,5 s.d. 8,0 (Josua, 2010). Dari hasilpengamatan didapatkan pembahasan bahwa pada tabung reaksi yang diberiperlakuan ditempatkan pada pH Larutan HCl 0,4% (pH=1), mengandungbanyak polisakarida dan sedikit monosakarida ataupun oligosakarida. Hal inidikarenakan enzim dalam kondisi pH yang jauh dari rentang pH optimum danmengalami denaturasi yang reverrsible (dapat balik). sehingga hanya sedikitterjadiataupunbahkantidakterjadireaksienzimatisantaraenzimamilasedenganamilum. Pada tabung yang diberi perlakuan ditempatkan pada pH aquades(pH=7), mengandung sedikit polisakarida dan sedikit monosakarida ataupunoligosakarida. Hal ini dikarenakan enzim dalam kondisi pH yang dekat darirentang pH optimum sehingga terjadi reaksi hidrolisis amilum (polisakarida)menjadi oligosakarida maupun monosakarida dengan bantuan enzim amilasesecara cukupoptimum. Pada tabung reaksi yang diberi perlakuan ditempatkanpada Larutan Na2CO3 0,1% (pH=9), tidak mengandung polisakarida sama

    sekalidankandunganmonosakaridamaupunoligosakaridayangsedikit.Hal inidisebabkankarenakondisipHtersebutdekatdenganrentangpHoptimumdanreaksi hidrolisis amilum dengan bantuan enzim amilase terjadi secara cukupoptimum.Pengaruhsuhuterhadapaktivitasenzimamilasedapatdituliskansebagaiberikut.RentangpHoptimumdarienzimamilase (ptialin)menyesuaikandenganpH rongga mulut yaitu antara 7,5 s.d. 8,0 (Josua, 2010). Pada rentang pHoptimum tersebut, aktivitas enzimatis terjadi secara optimal. Pada pH rendahataupun pH tinggi yang jauh di luar dari rentang pH optimumnya aktivitasenzimatis berkurang bahkan tidak terjadi karena enzim mengalami denaturasi

  • reverrsible (dapat balik). Dapat balik di sini dimaksudkan, enzim dapat aktifkembaliapabilaenzimmemasukikondisipHoptimumkembali.

    Padaujipengaruhkonsentrasienzimterhadapaktivitasenzim,digunakan3tabungyangberisiamilumdengankonsentrasiyangsamatetapikonsentrasienzimamilasenyaberbeda.Padauji benedict, ketiga tabungyangmasingmasingberisiamilumdengankonsentrasiamilase0,5ml,1,0ml,dan1,5mlmenghasilkanwarnabirumuda.Halinimenunjukkanbahwaenzimamilasetidakbekerjasecaraoptimaldalam menghodrolisis amilum yang ditandai dengan uji benedict yang negative.Akan tetapi, seharusnya pada uji benedict harus dilakukan pemasan agar hasilyang didapatkan lebih jelas. Pada uji iodium, tabung yang berisi amilumdengankonsentrasi amilase 0,5 ml dan 1,5 ml menghasilkan warna biru tua. Hal inimenunjukkan bahwa amilum tidak terhidrolisa dengan baik oleh enzim amilasemenjadi monosakarida. Sedangkan pada tabung yang berisi amilum dengankonsentrasiamilase1,0mlmenghasilkanwarnacoklatpekat.Halinimenunjukkanbahwaenzimbekerjadenganbaikdalammenghidrolisaamilum.

    Pada uji pengaruh konsentrasi substrat terhadap aktivitas enzimmenggunakan konsentrasi enzim yang sama dengan konsentrasi amilum yangberbedabedayaitu1ml,2ml,4ml,dan6ml.Padasaatdiujidengan iodium,tabungyangmenggunakankonsentrasiamilum2mlmenghasilkanwarnabening.Adanya warna bening ini menunjukkan bahwa amilum terhidrolisis oleh enzimamilase. Sedangkan tabung yangmenggunakan konsentrasi amilum 1ml, 4ml,dan6mlmenghasilkanwarnabirupekat.Semakinpekatwarnayangdihasilkanmaka masih banyak amilum yang tidak terhidrolisis oleh enzim amilase. Hal initidak sesuai dengan landasan teori bahwa pada konsentrasi enzim yang tetap,penambahan konsentrasi substrat akan menaikkan kecepatan reaksi enzimatissampaimencapaikecepatanmaksimumyangtetap.Penambahansubstratsetelahkecepatanmaksimum tidak berpengaruh lagi, sebab telahmelampaui titik jenuhenzim(Yazid,2006).Padasaatdiujidenganbenedict,tabungyangmenggunakankonsentrasiamilumsebanyak1mldan2mlmenghasilkanwarnabirukehijauan.Hal ini menunjukkan bahwa enzim bekerja dengan baik karena amilum telahterhidrolisis menjadi monosakarida sehingga bereaksi positif dengan benedict.Sedangkan pada tabungyangmenggunakankonsentrasi amilum sebanyak4mldan6mlmenghasilkanwarnabirubening.Halinimenunjukkanbahwaenzimtidakbekerjadenganbaikkarenaamilumtidakterhidrolisisolehenzimamilasesehinggatidakbereaksipositif denganbenedict. Seharusnyapadauji benedict dilakukanpemanasanterlebihdahuluagarhasilnyalebihbaik.

    Pada praktikum uji gmelin yang kami peroleh yaitu pada tabung yangberisi HNO3 yang telah ditetesi dengan 1 ml empedu pekat secara hati hati

    sehinggakedualarutantidakbercampurmenghasilkanwarnadaribawahkeatasbening, orange, hijau kebiruan, ungu dan kuning,.Sedangkan pada tabung yangtelah berisi iodium yang telah ditetesi dengan 1ml empedu pekatmenghasilkanwarnahijautua,halinimenandakanadanyapigmenpigmenwarnaempedupadakeduatabungtersebut.

    Padapraktikumujipettenkoferkamimemasukkan1ml larutanempedupekat,2teteslarutansukrosa5%,danmenuangkan10tetesH2SO4pekatsecara

    perlahanlahan, dari hasil praktium tersebut diperoleh hasil yaitu bening,merahviolet,keemasan,dancoklat.padabatasantarakedualarutanterbentukpembatascincinberwarnamerahviolet.(Tutinaningsih,2010)

    VII.KesimpulanBerdasarkanpembahasandiperolehkesimpulanbahwapadaujipengaruh

    suhu terhadap aktivitas enzimmenunjukkan suhu berpengaruh terhadap aktivitas

    enzim. Pada suhu rendah (0oC) sifat katalis enzimmenjadi inaktif, sedangkan

    padasuhutinggi(100oC)enzimmenjaditerdenaturasisehinggakehilanganfungsi

    enzimatisnya.Padasuhukamar(2530oC) terjadiaktivitasenzimatisyangcukupoptimal. Setiap enzim masingmasing memiliki rentang suhu optimum yang

    berbedabeda,umumnyaberkisarpadarentangsuhu2040oC.PadaujipengaruhpHterhadapaktivitasenzim,pHberpengaruhterhadap

  • aktivitas enzim. Setiap enzimmasingmasingmemiliki rentang pH optimum yangberbedabeda, sesuai dengan pH lingkungan tempat enzim bekerja. Pada pHrendahataupunpHtinggiyangjauhdiluardarirentangpHoptimumnyaaktivitasenzimatis berkurang bahkan tidak terjadi karena enzim mengalami denaturasireverrsible(dapatbalik).

    Pada uji pengaruh konsentrasi enzim terhadap aktivitas enzim, aktivitasenzim paling baik ditunjukkan pada konsentrasi amilum 2ml dengan konsentrasienzim amilase 1,0ml. Pada uji pengaruh konsentrasi substrat terhadap aktivitasenzim,aktivitasenzimyangpalingbaikditunjukkanpadakonsentrasiamilum2mldengan konsentrasi enzim amilase 1 ml. Pada uji gmelin diketahui empedumengandung bermacam macam pigmen. Pigmen empedu yang utama adalahbiliverdin yang berwarna hijau dan bilirudin yang berwarna jingga atau kuningcoklat.OksidasipigmenpigmenempeduolehoksidatorkuatsepertiHNO3akan

    menghasilkan turunan senyawa yang berwarna.Misalnya:Mesobiliverdin (biru

    hijau), Mesobilirubin (kuning), Mesobilisianin (biru ungu/violet). Pada ujipattenkofer, larutan sukrosa dengan H2SO4 akan terbentuk gula heksosa yang

    kemudian membentuk suatu senyawa hidriksimetilfurfural yang dengan adanyacairanempeduakanterbentuksuatucincinmerahviolet.

    .VIII.DaftarPustaka

    Josua.2010.Enzim.Blog.Dalamhttps://josuasilitonga.wordpress.com/2010/10/07/enzim/?_e_pi_=7%2CPAGE_ID10%2C3158864390. Diakses pada tanggal 28Oktober2014.

    Lehninger. 1982. Dasardasar Biokimia. Terjemahan Maggy Thenawidjaja.Principlesof

    Biochemistry.Jakarta:Erlangga.Tutinaningsih,2010.BiokimiaUrine.Dalam

    http://treesnasmart.blogspot.com/2009/05/Biokimiaurine.html. Diakses padatanggal28oktober2014.

    Yazid,Estien.2006.PenuntunPraktikumBiokimia.Yogyakarta:ANDI

    IX.PertanyaanKegiatan1:UjiPengaruhSuhuterhadapAktivitasEnzim1.JelaskankegunaanujiIodiumdanBenedictdalampercobaan!

    Jawaban:Uji Iodium bertujuan membuktikan adanya polisakarida, dalam hal ini adalahamilum. Identifikasi ini didasarkan pada pembentukan kompleks adsorpsiberwarna spesifik oleh polisakarida akibat penambahan iodium. Reaksi amilumdengan Iodium menghasilkan berwarna biru kehitaman. UjiBenedict bertujuan membuktikan adanya gula reduksi (monosakarida maupunoligosakarida). Pengujian ini berdasarkan gula yangmempunyai gugus aldehida

    atauketonbebasmereduksi ionCu2+dalam suasana alakalismenjadiCu+ yangmengendap sebagaiCu2Oberwarnamerahbata.Reaksi positif ditandai dengan

    perubahan warna larutan menjadi hijau kekuningan, dan setelah dilakukanpemanasanterbentukendapanberwarnamerahbata,kepekatanwarnasebandingdengan kandungan gula pereduksi yang ada.Hasil dari uji Iodium dan benedictdijadikan sebuah indikator dalam menunjukkan apakah terjadi aktivitas enzimamilaseyangmenghidrolisisamilum(polisakarida)menjadimonosakaridamaupunoligosakaridapadarentangsuhutertentu.

    2.Padapercobaan,apakahsuhumempengaruhiaktivitasenzim?Mengapa?Jawaban:Iya, suhumempengaruhi aktivitaskerja enzimkarena tiapkenaikan suhu10C,kecepatan reaksi enzimatis menjadi 1,1 s.d. 3,0 kali lipat lebih cepat (Yazid,2006).Haliniberlakudalambatassuhuyangwajar.Kenaikansuhuberhubungandenganmeningkatnyaenergikinetikpadamolekulsubstratdanenzim.Padasuhuyang lebih tinggi, kecepatan molekul substrat meningkat. Sehingga, pada saatbertubrukan dengan enzim, energi molekul substrat berkurang. Hal inimemudahkanmolekulsubstratterikatpadasisiaktifenzim.Peningkatansuhuyang

  • ekstrimdapatmenyebabkanatomatompenyusunenzimbergetarsehinggaikatanhidrogenterputusdanenzimterdenaturasi.Denaturasiadalahrusaknyabentuktigadimensi enzim dan menyebabkan enzim terlepas dari substratnya. Hal ini,menyebabkan aktivitas enzim menurun, denaturasi bersifat irreversible (tidakdapatbalik).Setiapenzimmempunyaisuhuoptimum,sebagianbesarenzimhewanmamalia dan manusia mempunyai suhu optimum 37 C. Sebagian besar enzimtumbuhanmempunyaisuhuoptimum25C.

    3.Padasuhuberapadiperolehaktivitasenzimamilaseoptimal?Mengapa?Jawaban:Rentangsuhuoptimumenzimamilasebelumbisaditentukan.Rentangsuhuoptimalsuatuenzimtidakdapatdilakukanhanyadenganperlakuanpadasaturentangsuhunonekstrim saja, melainkan pada berbagai rentang suhu. Namun, pada suhu

    kamar(2530oC)terjadiaktivitasenzimatisyangcukupoptimal.4. Sebutkan tigaenzim lainyangdapatmenghidrolisiskarbohidrat,masingmasing

    dengansumbernya!Jawaban:Enzimyangmenghidrolisiskarbohidratdiantaranyasebagaiberikut.Enzimamilasesalah satunya diproduksi pada kelenjar saliva dan terdapat pada air liur. Enzimglukoamilase diproduksi oleh Aspergillus dan Rhizopus. Enzim laktase yangberfungsiuntukmengubahlaktosamenjadiglukosadangalaktosadiproduksipadatanaman yaitu peach dan apel, sedangkan pada hewan vertebrata yaitu bagianjejunum.Enzim selulose berfungsi untukmenguraikan selulosamenjadi selabiosaatau disakarida dapat ditemukan pada saluran pencernaan hewanhewanherbivora,dihasilkanolehbakterisimbiotik.

    Kegiatan2:UjiPengaruhpHterhadapAktivitasEnzim1.Padapercobaan,apakahpHmempengaruhiaktivitasenzim?Mengapa?

    Jawaban:Ya,pHsangatmempengaruhiaktivitaskerjaenzim.Setiap enzimmasingmasingmemiliki rentangpHoptimumyangberbedabeda, sesuaidenganpH lingkungantempatenzimbekerja.Jikadilakukanpengukuranaktivitasenzimpadabeberapamacam pH yang berlainan, sebagian besar enzim di dalam tubuh akanmenunjukkan aktivitasmaksimum antara pH 5,0 sampai 9,0. Kecepatan reaksienzimatikmencapai puncaknya pada pH optimum.Ada enzim yangmempunyaipHoptimumyangsangatrendah,sepertipepsin,yangmempunyaipHoptimum2menyesuaikan dengan pH lingkungan lambung. Pada pH yang jauh di luar pHoptimum,enzimakanterdenaturasiyangbersifatreverrsible(dapatbalik).

    2.PadapHberapadiperolehaktivitasenzimamilaseyangoptimal?Mengapa?Jawaban:Berdasarkan referensiyangdidapatdiketahuibahwa rentangpHoptimumenzimamilase(ptialin)menyesuaikandenganpHronggamulutyaituantara7,5s.d.8,0(Josua,2010).BerdasarkanhasilpengamatandidapatrentangpHoptimumenzimamilase (ptialin) antara pH 7 s.d 9. Hal tersebut dapat dilihat dari indikatorperubahanwarnayangterbentuksetelahdiujiIodiumdanBenedict.

    Kegiatan3:UjiPengaruhKonsentrasiEnzimTerhadapAktivitasEnzim

    1. Pada konsentrasi (volume) enzim berapa diperoleh aktivitas enzim amilaseoptimal?Mengapa?

    Jawaban:

    Aktivitas enzim amilase optimal pada konsentrasi enzim1,0 ml. Karena padakonsentrasi ini, setelah di uji dengan iodium menghasilkan warna coklat pekat.Akantetapipadaujibenedictnyaenzimtidakdapatbekerjasecaraoptimalkarenaamilumtidakterhidrolisisolehenzim.

  • PostingLebihBaru PostingLamaBeranda

    Langganan:PoskanKomentar(Atom)

    Diposkanolehriskiangestidi22.48

    Kegiatan4:UjiPengaruhKonsentrasiSubstratTerhadapAktivitasEnzim

    1. Pada konsentrasi substrat berapa diperoleh aktivitas enzim amilase optimal?Mengapa?

    Jawaban:

    Aktifitasenzimamilaseoptimalpadakonsentrasi(volume)substrat2ml.Karenapadakonsentrasi ini,setelahdiujidenganiodiummenghasilkanwarnabeningdansetelahdiujidenganbenedictmenghasilkanwarnabirukehijauan.

    Kegiatan5:UjiGmelin1.Apakahkegunaanlarutaniodiumdalampercobaan?Jelaskan!

    Jawaban:Kegunaanlarutaniodiumdalampercobaandiatasadalahuntukpengoksidasianzatwarnadalamempedu.

    Kegiatan6:UjiPettenkofer1.Apakahkegunaansukrosadalampercobaan?

    Jawaban:Kegunaansukrosadalampercobaandiatasadalahberfungsisebagaipengoksidasizatwarnaempedu.

    2.Sebutkanmasingmasingduafungsidariasamempedudangaramempedu?Jawaban:Fungsigaramempedu:a.Berperandalamemulsilemak,b.Berperandalammengeluarkanbeberapaprodukbuangandaridarahantara

    lainbilirubin,suatuprodukakhirdaripenghancuranhemoglobindankelebihankolestrolyangdibentukolehselselhati.

    Fungsiasamempedu:a.Asamempedumembantumegemulsipartikelpartikellemakyangbesar

    menjadipartikelyanglebihkecil.b.Asamempedumembantutransportdanabsorbsprodukakhirlemakyang

    dicernamenembusmembranesel.

    +1 Rekomendasikan ini di Google

    Keluar

    Beritahusaya

    MasukkankomentarAnda...

    Berikomentarsebagai: WawanWibisono(Google)

    Publikasikan Pratinjau

    Tidakadakomentar:

    PoskanKomentar

  • TemplateWatermark.DiberdayakanolehBlogger.