International Secondary Catalogue 2019

International SecondaryCatalogue 2019

Resources for schools following a UK, International, or International Baccalaureate Curriculum

www.pearsonglobalschools.com

WelcomeThis catalogue is for schools who have chosen to follow a UK, International or International Baccalaureate© curriculum, and contains a selection of our new and bestselling resources for 11-18 year olds.

Inside you’ll find resources that are aligned to the latest education practices and meet the needs of today’s learners around the world. They are designed to help you:l save time planning so you’re ready to teachl impact on learner outcomes to help

students reach their full potentiall track every student’s progress and help you

prepare for assessment during times of change.

As you help learners aim higher and fulfill their true potential, you can rely on Pearson’s leading school resources for support at all stages of planning, teaching, learning and assessment.

Pearson is focused on helping all learners discover a love of learning that will inspire them and provide opportunities throughout their lives. Because wherever learning flourishes, so do people.

Contents2 Resources finder Usetheresourcefindertoquicklylocate

resourcesbysubject,agerangeandqualification.

4 Pearson for International Schools AtaglanceviewofwhatPearsoncanoffer

yourschool.

8 UK Curriculum Overview LearnabouttheUKacademiccurriculum.

14 UK Digital Resources How ActiveLearn Digital Service supports

21stCenturyLearning.

16 UK Resources • Mathematics (pages 16–33) • Science (pages 34–49) • English (pages 52–65) • ModernForeignLanguages(pages66–75) • History(pages76–80) • Geography(pages82–83) • Business(pages84–88)

50 Lower Secondary Curriculum • iLowerSecondary(page50) • MappedResourcesforiLowerSecondary

(page 51)

90 International Baccalaureate© Resources

ResourcesforMYPandDP

104 Index

How to order Informationonhowtocontactusandplace

yourorder.

*Middle Years Programme (MYP) and Diploma Programme (DP) are trademarks of the International Baccalaureate Organization (IB), which was not involved in the production of, and does not endorse these products.

®IGCSE is the registered trade mark of University of Cambridge International Examinations.

Find the resource for your curriculum needsUse the following symbols to locate resources at a glance.

Digital Resources

Suitable for English Language Learners

1

NEW FOR 2019 iProgress with Pearson Edexcel

see page 9

iProgress is our complete series for 5 to 18 year-olds, for international schools. The iProgress family includes iPrimary, iLowerSecondary, International GCSE and International Advanced level, delivering a consistent learning journey for students and teachers, everywhere in the world.

iLowerSecondary see page 50

Pearson Edexcel iLowerSecondary is a complete, three year programme for use in international secondary schools. As well as the curriculum itself, the programme also comes with a wealth of support with sample schemes of work, exemplified units of work, internally assessed progress tests, externally assessed achievement tests and a comprehensive professional development programme – all supported by world-renowned Pearson print and digital courseware.

Dynamo see page 66

Dynamo is our brand-new course for KS3 French, with up-to-date cultural content and an active approach to learning grammar which will motivate and engage your students.

IB Diploma Mathematics see pages 95

2019 sees big changes to the International Baccalaureate Diploma Mathematics curriculum. Our four new Textbooks and eTexts fully support the new Mathematics Guide. With Standard Level and Higher Level versions for Analysis and Approaches; and SL and HL versions for Applications and Interpretation - we have all the new routes covered!

2

SERIES NAME PAGE SUBJECT AGE RANGE QUALIFICATION

ActiveLearn Digital Service (ALDS)Bringingtogetheryourplanning,teachingandassessmentacrossoneservice,ALDSsavesyouvaluabletimeandprovidesyouwithallyouneedtocreateapersonalisedteachingandindependentlearningexperiencebothinandoutsidetheclassroom.

14-15 All 11-18 Various

KS3 Maths ProgressNurtureconfidence,buildfluency,improveproblem-solvingskillsanddevelopmathematicalreasoningthroughoutourtrustedsuiteofdigitalandprintresources.

16-19 Mathematics 11-14 iLowerSecondary

Pearson Edexcel International GCSE (9–1) MathematicsForthePearsonEdexcelInternationalGCSE(9–1)specification,theseresourceshaveprogression,internationalrelevanceandsupportattheircore.

20-23 Mathematics 14-16 PearsonEdexcelInternational GCSE

(9–1)

Pearson Edexcel GCSE (9–1) MathematicsBuildsfluencyandnurturesstudentconfidencewithaunique,differentiatedunitstructure,focussingonproblem-solvingandreasoningthroughout.

24-25 Mathematics 14-16 PearsonEdexcelGCSE (9–1)

Pearson Edexcel GCSE (9–1) StatisticsDevelopedinlinewiththekeyprinciplesofthenewspecification,ourbrandnewEdexcelGCSE(9-1)statisticswilldevelopconfidentstatisticians.

26 Mathematics 14-16 PearsonEdexcelGCSE (9–1)

Edexcel Core Maths: Maths in ContextFullofreal-worldmathematicalproblemsolving,MathsinContextistheonlycoursewrittenfortheEdexcelMathematicsinContextspecification.

27 Mathematics 14-16 EdexcelMathematicsinContext

Pearson Edexcel International A Level (IAL) MathematicsSpecificallydesignedforinternationalstudents,withastrongfocusonprogression,recognitionandtransferableskills,allowinglearninginalocalcontexttoaglobalstandard.

28-31 Mathematics 16-18 PearsonEdexcelInternational A Level

(IAL)

Pearson Edexcel AS and A Level Mathematics Designedtomatchthenewlinearexamstructure,providinglotsofpracticeforthenewstyleofquestions.

32-33 Mathematics 16-18 PearsonEdexcel ASandALevel

KS3 Exploring Science: Working ScientificallyComprehensivedigitalandprintserviceforallyourplanning,teaching,learning,homeworkandassessmentneedsforthenewcurriculum.

34-37 Science 11-14 iLowerSecondary

Pearson Edexcel International GCSE (9–1) Science Specificallydevelopedforinternationallearners,withappropriateinternationalcontent,makingitengagingandrelevantforalllearners.

38-41 Science 14-16 PearsonEdexcelInternational GCSE

(9–1)

Pearson Edexcel GCSE (9–1) ScienceDesignedtobestraightforward,inclusiveandinspiring–helpingtodelivergreatscienceteachingandcreateconfidentlearners.

42-43 Science 14-16 PearsonEdexcelGCSE (9–1)

Pearson Edexcel International A Level (IAL) ScienceSpecificallydesignedforinternationalstudents,puttinglearninginareal-worldcontext,toaglobalstandard,makingteachingengagingandrelevantforalllearners.

44-47 Science 16-18 PearsonEdexcelInternational A Level

(IAL)

Pearson Edexcel AS and A Level ScienceDevelopedwithexpertstocreateapproachesthatembedlearningofscientificconceptsandskills,helpingstudentstoovercomebarrierstolearning,developingintoconfidentandindependentscientists.

48-49 Science 16-18 PearsonEdexcel ASandALevel

iLowerSecondaryAcompleteprogrambasedonthelatestEnglishNationalCurriculum(2014),butdesignedwithaglobaloutlook,forchildrenaged11to14.

50-51 Various 11-14 iLowerSecondary

KS3 Skills for WritingUniquedigitalandprintsolutiondesignedtoaccelerateprogressinwritingbyembeddingtheprinciplesoftheprovenGrammarforWritingpedagogy.

52-53 Literacy 11-14 iLowerSecondary

Pearson Edexcel International GCSE (9–1) EnglishWrittenbyateamofhighlyexperiencedEnglishteachers,authorsandacademics,thesenewresourceshaveprogression,internationalrelevanceandsupportattheircore.

54-57 Literacy 14-16 PearsonEdexcelInternational GCSE

(9–1)

Resource FinderThis catalogue features the following selection of resources for International Schools. For details of addditional resources visit www.pearsonglobalschools.com

3

SERIES NAME PAGE SUBJECT AGE RANGE QUALIFICATION

Pearson Edexcel GCSE (9–1) English LanguageOurnewresourceswillhelpprepareyourstudentsforthemoredemandingcontentandhigherexpectationsofthenewGCSEinEnglishLanguage.

58-59 Literacy 14-16 PearsonEdexcelGCSE (9-1)

New WindmillsWithover200titles,award-winningauthorsandastaggeringvarietyoftitlesandstories,NewWindmillshaslongbeenthefirstchoiceforliteratureinEnglishclassrooms.

60-65 Literacy 11-14

DynamoOurbrand-newcourseforKS3Frenchwithup-to-dateculturalcontentandouractiveapproachtolearninggrammarwillmotivateandengageyourpupils.

66-70 Languages 11-14

Studio (French)StudiomovesattherightpaceforyourpupilsandopensthewindowtotheFrench-speakingworld.

71 Languages 11-14

Stimmt! (German)Stimmt!11-14Germanresourcesarepackedwithcontentyourpupilswillenjoylearning,usingatried-and-testedteachingapproach.”

72 Languages 11-14

Viva! (Spanish)¡Viva!11-14Spanishresourcesmoveattherightpace–whetherornotyourpupilshavepriorknowledge–andtheyopenthewindowtotheSpanish-speakingworld.

73 Languages 11-14

Lanuages Resources for GCSE 9–1OurFrench,GermanandSpanishresourcesofthenewUKGCSEqualificationsfocusongrammar,translation,understandingauthenticandliterarytexts,andspeakingspontaneously.

74-75 Languages 14-16 PearsonEdexcelGCSE (9–1)

KS3 Exploring HistoryProvidesaspecificallydesignedpathwaytotheEdexcelGCSE(9-1)Historyqualification.ThiscoursebuildsthefoundationsstudentsneedtosucceedatGCSE,withoutrepeatingcontent.

76-77 History 11-14

Pearson Edexcel International GCSE (9–1) HistoryDevelopedforthenewPearsonEdexcelInternationalGCSE(9-1)specification,thesenewhistoryresourceshaveprogression,internationalrelevanceandsupportattheircore.

78-79 History 14-16 PearsonEdexcelInternational GCSE

(9–1)

Pearson Edexcel GCSE (9-1) HistoryProvidesanintegratedapproachtodevelopingconfident,articulateandsuccessfulhistorians.

80 History 14-16 PearsonEdexcelGCSE (9–1)

Pearson Edexcel International GCSE (9–1) GeographySpecificallydevelopedforinternationallearnerstosupplystudentswiththebestpreparationpossiblefortheexamination.

82 Geography 14-16 PearsonEdexcelInternational GCSE

(9–1)

Pearson Edexcel GCSE (9-1) Geography A and BSupportsdevelopmentofkeyskillsyourstudentsneedtobecomeconfidentgeographers.

83 Geography 14-16 PearsonEdexcelGCSE (9–1)

Pearson Edexcel International GCSE (9–1) Accounting, Business, Economics and ICTThesenewresourceshavebeendevelopedforthelatestPearsonEdexcelInternationalGCSE(9–1)specificationwithprogression,internationalrelevanceandsupportattheircore.

84-85 Business 14-16 PearsonEdexcelInternational GCSE

(9–1)

Pearson Edexcel International A Level (IAL) Business and EconomicsThesenewresourcesarespecificallydesignedforinternationalstudents,withastrongfocusonprogression,recognitionandtransferableskills,allowinglearninginalocalcontexttoaglobalstandard.

86-87 Business 16-18 PearsonEdexcelInternational A Level (IAL)

Pearson Edexcel International A Level (IAL) ITInternationalALevelITusesappropriateinternationalcontenttoputlearninginareal-worldcontext,makingitengagingandrelevantforalllearners.

88 Business 16-18 PearsonEdexcelInternational A Level (IAL)

International Maths for the Middle YearsDevelopedspecificallyfortheinternationalstudent,thisfive-bookseriesgivesstudentstheopportunitytolearnMathematicswithaglobalperspective.

92-93 Mathematics 11-14 International Baccalaureate

International Baccalaureate DiplomaThePearsonBaccalaureateseriesprovidesallyouneedtoteachandstudytheIBDiplomaseries.

94-101 Various 14-18 International Baccalaureate

4

Pearson for International SchoolsPearson has a simple mission: to help make a measurable impact on improving people’s lives through learning. We ensure that schools and students who choose an international education are equipped to progress.

Ages 5-11 Ages 11-14 Ages 14-16 Ages 16-18

A consistent learning

journey to ensure outstanding achievement

and progression to further education,

university and employment

Curriculum and qualifications

iPrimary (UK curriculum)

iLowerSecondary(UK curriculum)

International GCSEGCSEBTEC

International A Level GCE A Level

BTEC

Published teaching and learning resources

UK and iPrimary matched resources

IB PYP

iLowerSecondary matched resources

UK KS3

International GCSE UK GCSE

BTEC

International A Level/UK GCE A Level

BTECIB Diploma

Training, professional development and advanced support tools and services

Our qualifications and resources are supported by a range of training and professional development. Our technology capability also allows us to offer more advanced tools and services such as ActiveLearn Digital, our online teaching and learning service, and ResultsPlus,

our online results analysis tool.

Confidence in a complete, integrated teaching and learning experience for you and your students

5www.pearsonglobalschools.com

Ages 5-11 Ages 11-14 Ages 14-16 Ages 16-18

A consistent learning

journey to ensure outstanding achievement

and progression to further education,

university and employment

Curriculum and qualifications

iPrimary (UK curriculum)

iLowerSecondary(UK curriculum)

International GCSEGCSEBTEC

International A Level GCE A Level

BTEC

Published teaching and learning resources

UK and iPrimary matched resources

IB PYP

iLowerSecondary matched resources

UK KS3

International GCSE UK GCSE

BTEC

International A Level/UK GCE A Level

BTECIB Diploma

Training, professional development and advanced support tools and services

Our qualifications and resources are supported by a range of training and professional development. Our technology capability also allows us to offer more advanced tools and services such as ActiveLearn Digital, our online teaching and learning service, and ResultsPlus,

our online results analysis tool.

Confidence in a complete, integrated teaching and learning experience for you and your students

6

Published Resources

We also offer a wide range of printed and online teaching and learning resources to accompany our qualifications.

These resources include support for curriculum planning and delivery, class teaching and learning, homework and revision, progression tracking and intervention, and ongoing assessment.

Learn more about some of these resources throughout this catalogue and online www.pearsonglobalschools.com.

Helping to meet your 11-19 challengesGive your learners the best chance of success with our unique and integrated combination of qualifications, teaching and learning resources and training.

Qualifications

We offer a range of qualifications including iLowerSecondary GCSE, International GCSE, A Level and International A Level.

Whether you’re teaching, studying or administering a Pearson qualification, you’ll find a wide range of support to help you at every stage of planning, delivery, through to post results.

This support includes our ResultsPlus service, expert subject advisors and a range of free support materials online.

Learn more at qualifications.pearson.com.

https://qualifications.pearson.com/en/home.html

UK CU

RRICULU

MAG

ES 11–18

7www.pearsonglobalschools.com/progressionservices

ActiveLearn: Progress and Assess With years of experience creating qualifications and resources, we’ve combined our skills to provide you with a consistent method of tracking student progress and reporting across multiple subjects, providing comprehensive support for 11-16 progression.

Use these tools and resources alongside your own method and add value to what you are already doing without duplicating effort. Our curriculum-led approach provides you with: assessments that offer you additional reliability, validity and accuracy in reporting; the confidence to apply appropriate and timely interventions; breadth and depth of student performance data captured by our reporting tools.

What makes up ActiveLearn: Progress and Assess?l 12 step progression scale.

l Progression maps.

l Baseline assessments for KS3 and KS4.

l End of topic, end of term and end of year assessments.

l Mark schemes for all assessments.

l Mark books that provide analysis of students’ results.

l Online reporting (for Maths).

ActiveLearn: Progress and Assess is included in many of our KS3 and GCSE resources. They are also available to purchase standalone so you can use it alongside your own method:

SUBJECT KS3 KS4 11–16

Wholeschool(allsubjects) 3 3 3

Maths 3 3 3

English 3 3 3

Science 3 3 3

ModernForeignLanguages 3 3 3

Geography 3 3 3

History 3 3 3

A full component list with ISBNs and prices is available at www.pearsonglobalschools.com/progressionservices

8

UK academic curriculum

Pearson Edexcel set the standard for worldwide recognised qualifications, built on the UK educational system and accepted by universities worldwide.

We have a simple mission: to help make a measurable impact on improving people’s lives through learning.

Why choose Pearson Edexcel?

As the UK’s largest awarding organisation, Pearson Edexcel are best placed to provide international qualifications that are recognised as being most closely aligned to the British educational system. Pearson, also offer vocational and professional qualifications such as BTEC and LCCI, as well as UK regulated qualifications - GCSE and GCE A Level.

Pearson Edexcel is the most reliable awarding organisation in the UK, recognised and trusted by educators, learners and employers to provide high quality qualifications.

We also help you empower students to progress to further education, university and employment by integrating transferable skills into our qualifications and resources. These skills have been highlighted by universities and employers as a key requirement.

We provide a competitive range of support services, tools and resources alongside our qualifications, making learners’ and teachers’ lives easier. This includes local and global customer support, subject advisors, a range of published resources, teacher training and professional development courses. Our technology capability also allows us to provide the following unique services and tools: ExamWizard, ResultsPlus, ePEN and Access to Scripts Service.

“ We judge ourselves – and invite others to judge us – not by the products that we make but by the impact on learners.”

John Fallon, Chief Executive Officer, Pearson

AGES 5–18

9

UK CU

RRICULU

MiProgress with Pearson EdexceliProgress is our complete series for 5 to 19 year-olds, for international schools. The iProgress family includes iPrimary, iLowerSecondary, International GCSE (IG), International Advanced level (IAL) and delivers a consistent learning journey for students and teachers, everywhere in the world.

Linear structure with external exams at the end of year 6

Linear structure with external exams at the end of year 9

International GCSE: Linear structure with all exams available in June and many subjects available in January

International GCSE: Linear structure with exams available in June

International Advanced Level: Modular structure with exams in January, June and October for most subjects.

GCE A level: linear structure with exams in June

IAL: Modular structure

Full range of curriculum support resources, tools and services including training, professional development, print and online teaching materials

English, mathematics and science

5–11 years 11–14 years 14–16 years 16–18 yearsEnglish, mathematics and science

Available in more than 37 subjects

Available in 21 subjects

iPrimary iLowerSecondary International GCSE (9–1)

International Advanced Level (IAL)

More than just a curriculum or qualificationiProgress offers professional development and training that keeps teachers up-to-date with the latest educational practices, so you’ll have more time to focus on the development of your students’ progress.

10

International GCSEOur suite of Edexcel International GCSEs (9–1) are comparable to the reformed UK GCSEs (9–1) in terms of the level of demand, assessment standards and progression opportunities. Our International GCSEs:

l Reward outstanding academic achievement by fully aligning with UK government intentions to raise standards so that students are ideally placed to make progress to International A Levels (IAL), universities and employment

l Lead the way with the new 9–1 grading scale, carefully re-developed to be appropriate for this grading scale

l Meet the needs of today’s learners to ensure they are equipped for university and employment with embedded transferable skills in the qualifications and resources

l Are designed for international students with the introduction of more appropriate content topics and the use of local contexts where possible, making our International GCSE even more relevant and engaging for students around the world, allowing for learning in a local context to a global standard

l Offer more advanced support services, tools and resources with ResultsPlus, ResultsPlus Direct, ExamWizard, and Subject Advisors, ePen marking technology and the new free Access to Scripts (ATS) service provide you with even more support and reassurance around results and post-results support.

Published Pearson resources for Edexcel International GCSE (9–1)

SUBJECT PAGE

Accounting Seepages84–85

Biology Seepages38–41

Business Seepages84–85

Chemistry Seepages38–41

Economics Seepages84–85

EnglishasaSecondLanguage Seepages54–57

EnglishLanguage(SpecificationA) Seepages54–57

EnglishLanguage(SpecificationB) Seepages54–57

English Literature Seepages54–57

FurtherPureMathematics Seepages20–23

Geography Seepage82

History Seepages78–79

HumanBiology Seepage38–41

InformationandCommunicationTechnology(ICT) Seepages84–85

Mathematics(SpecificationA) Seepages20–23

Physics Seepages38–41

Science(DoubleAward) Seepages38–41

Learn more about the full range of International GCSE subjects at qualifications.pearson.com/edexcel-internationalgcse

UK CU

RRICULU

MAG

ES 14–16


UK GCSEGCSEs (General Certificates of Secondary Education) are regulated qualifications taken by 14- to 16-year-olds in schools and colleges in the UK and are also available to the majority of international schools. New GCSEs have been taught in schools in England from September 2015, with the first results issued in August 2017.

The main features of the new GCSEs are:

l A new grading scale of 9 to 1, with 9 being the top grade. This allows greater differentiation between students and will help distinguish the new GCSEs from previous versions.

l Assessment mainly by exam, with other types of assessment used only where they are needed to test essential skills.

l New, more demanding content, which has been developed by government and the exam boards.

l Courses are designed for two years of study – they are no longer divided into different modules and students now take all their exams in one period at the and of their course.

l Exams can only be split into ‘foundation tier’ and ‘higher tier’ if one exam paper does not give all students the opportunity to show their knowledge and abilities.

l Resit opportunities are only be available each November in English language and maths.

Published Pearson resources for Edexcel GCSE (9–1)


SUBJECT FIRST TEACHING FIRST TEACHING

Biology 2016 See pages 42–43

Business 2017 See online

Chemistry 2016 See pages 42–43

CombinedScience 2016 See pages 42–43

Computer Science 2016 See online

English Language 2015 Seepages58–59

French 2016 Seepages74–75

GeographyA 2016 Seepage83

GeographyB 2016 Seepage83

German 2016 Seepages74–75

History 2016 Seepage80

Mathematics 2015 See pages 24-25

PhysicalEducation 2016 See online

Physics 2016 See pages 42–43

ReligiousStudiesB 2016 See online

Spanish 2016 Seepages74–75

Learn more about the full range of GCSE subjects at qualifications.pearson.com


12

International A Level (IAL)We’ve updated our International Advanced Level (IAL) qualifications in 8 subjects: Biology, Chemistry, Physics, Business, Economics, Mathematics, Further Mathematics and Pure Mathematics. We have also created a brand new Information Technology qualification.

International qualifications for international students, and not available in the UK. During the consultation, teachers and higher education institutions from around the world have provided in-depth feedback on the proposed content and assessment methods of the updated Edexcel IALs. As a result, the qualifications will continue to be relevant and engaging for students around the world, allowing for learning in a local context to a global standard.

Recognised by universities worldwide and fully comparable to UK reformed GCE A levels, they provide the same progression routes to university and employment. Crucially, all Edexcel IALs are widely recognised by universities across the world for entry on to undergraduate degree level programmes. Global universities that recognise these qualifications include the UK Russell Group, the Australia Group of 8 (Go8) and top ranked universities in North America and Asia.

Developing transferable skills valued by universities and employers by embedding and signposting transferable skills throughout, students engage with these essential skills which are sought after by universities and employers across the world.

Providing support at every stage of the learning journey so you can deliver the updated Pearson Edexcel IALs with confidence and achieve the best possible learner outcomes, including Sample Assessment Materials, Schemes of Work, Exemplars with examiner commentaries, Getting Started Guide, ResultsPlus service, Exam Wizard and Getting Ready to Teach events. In addition, new published textbooks and interactive resources will also be available.

The new print and digital resources for the updated Pearson Edexcel IALs are written for the latest specifications, so you can be confident that you are covering all aspects of the specification, providing your students with the best chance of succeeding. They are specifically designed for international students, with appropriate international content, making the print and digital resources relevant for all and allowing learning in a local context, to a global standard. Content has been checked by language specialists to ensure the language is clear and accessible.

NEW Published Pearson resources for the Pearson Edexcel International A Level

SUBJECT QUALIFICATION FIRST TEACHING DATE PUBLISHED RESOURCES

Biology 2018 Seepages44–47

Business 2018 Seepages86–87

Chemistry 2018 Seepages44–47

Economics 2018 Seepages86–87

InformationTechnology 2018 Seepages88

Mathematics 2018 Seepages28–31

Physics 2018 Seepages44–47

Learn more about the full range of International A Level subjects at qualifications.pearson.com/IAL

https://qualifications.pearson.com/en/qualifications/edexcel-international-advanced-levels.html?utm_source=edexcelinternational2015&utm_medium=Print&utm_campaign=SEC_GEN_19FEB2015_edexcelinternational2015

UK CU

RRICULU

MAG

ES 16–18


UK A LevelNew AS and A levels were introduced in schools in England from September 2015. The main features of the latest qualifications are:

l Assessment is mainly by exam, with other types of assessment used only where they are needed to test essential skills.

l AS and A levels are assessed at the end of the course. AS assessments will typically take place after one year’s study and A levels after two. The courses are no longer divided into modules (unlike International A Level which is still modular) and there will be no exams in January.

l AS and A levels will be decoupled – this means that AS results will no longer count towards an A level.

l AS levels can be designed by exam boards to be taught alongside the first year of A levels.

l The content for the new A levels has been reviewed and updated. Universities played a greater role in this for the new qualifications than they did previously.

Published Pearson resources for the Pearson Edexcel A Level FIRST TEACHING DATE SPECIFICATION LEVEL LEVEL PUBLISHED RESOURCES

2015 BiologyA(Salters-Nuffield) AL See online

2015 BiologyB AL See online

2015 Business AL Seepages86–87

2015 Chemistry AL Seepages48–49

2015 Economics A AL See online

2015 History AL See online

2015 Physics AL Seepages48–49

2015 Psychology AL See online

2017 Mathematics AS AL See pages 32–33

Learn more about the full range of A Level subjects at qualifications.pearson.com


14

ALDS

There are tens of thousands of teachers and their learners, just like you, logging into ActiveLearn Digital Service (ALDS) every day. Over 80% of UK schools use time-saving tools and innovative content to help them plan, teach, track and assess, all in one place. Will you join them?

Bringing together your planning, teaching and assessment across one service, ALDS saves you valuable time and provides you with all you need to assist you and your learners. It creates a personalised teaching and independent learning experience both in and outside the classroom.

l Make time to teach: Spend more time delivering inspirational lessons, building confidence in your learners and creating individual success with time saving resources for you and your learners. “Brilliant in terms of time saving for teachers’” - Jenny Lewis, Crookhorn College.

l Supporting change: ALDS contains everything you need to help you teach the new GCSE and AS/A level qualifications, so you can trust resources that are designed to support you in addressing the key changes to the new specifications and assessments.

l A personalised teaching and learning experience for you and your learners: Because not everyone teaches and learns in the same way. Fuel learners’ curiosity by creating and customising stimulating, inspiring lessons with front-of-class digital resources and allow them to develop their independent learning skills through online homework with a range of hints, tips and learning aids.

l Comprehensive reporting and two-way feedback to help all learners develop and progress: Helps learners develop and identify their personal needs both in class and independently while allowing you full view of exactly how the group and individual have performed.

l Support and training when you need it: We’ll help you get up and running and be available throughout so you can get the best out of the service for you and your learners.

ActiveLearn Digital Service

“ActiveLearn Digital Service is an incredibly well thought out online innovation that is rich in content, support and learning … a learner-centric dynamo.”

Teach Secondary

Evaluate ActiveLearn Digital Service with a free 60-day trial.

Request online at

www.pearsonglobalschools.com/ALDStrial

DIG

ITAL LEA

RNIN

GAG

ES 11–18

15

Features of ActiveLearn Digital Service

ActiveBook (e-book)Combining front-of-class teaching resources with online homework and practice, as well as planning and assessment materials. ALDS has been developed alongside our Student Books to give one coherent approach.

Homework, Practice & SupportOur homework, practice and support service is a motivating and supportive online independent learning resource with student activities and exercises for the classroom and at home – for Key Stage 3, GCSE and A level students.

Series powered by ActiveLearn Digital ServiceEnglish

l KS3 Skills for Writing (pages 52–53)

l Pearson Edexcel GCSE (9–1) English Language (pages 58–59)

Maths

l KS3 Maths Progress (pages 16–19)

l Pearson Edexcel GCSE (9–1) Mathematics (pages 24–25)

l Pearson Edexcel International GCSE (9–1) Mathematics (pages 20–23)

Science

l Exploring Science: Working Scientifically (pages 34–37)

l Pearson Edexcel GCSE (9–1) Science 2016 (pages 42–43)

Languages (pages 66-75)

l KS3 Studio (11–14 French)

l KS3 Stimmt! (11–14 German)

l KS3 ¡Viva! (11–14 Spanish)

l Pearson Edexcel GCSE (9–1) French

l AQA GCSE (9–1) French

l Pearson Edexcel GCSE (9–1) German

l AQA GCSE (9–1) German

l Pearson Edexcel GCSE (9–1) Spanish

l AQA GCSE (9–1) Spanish

Humanities (pages 80 and 83)

l Pearson Edexcel GCSE (9–1) History

l Pearson Edexcel GCSE Geography A & B

Teaching ServiceOur teaching service brings together the resources you need to plan and deliver lessons with front-of-class, planning and assessment materials all in one place and under one subscription.


16

KS3 Maths Progress

KS3 Maths Progress builds confidence in maths by using a unique approach to nurture confidence, build fluency, improve problem-solving skills and develop mathematical reasoning throughout our trusted suite of digital and print resources.

Written for the latest UK National Curriculum, the course’s unique structure helps create confident and numerate students who are fully prepared for the transition to Key Stage 4. KS3 Maths Progress and Edexcel GCSE (9–1) Mathematics offer you a consistent teaching and learning experience from 11 to 16.

Is it for me?l Developed to help build confidence in mathematics and

prepare your students for studying for the new GCSE.

l Supports your planning, teaching and assessing students’ progress.

l Caters for all attainment levels with differentiated Student Books.

l Focuses on problem-solving and mathematical reasoning skills.

l Provides plenty of extra practice for every topic.

What’s special?l A digital interactive scheme of work for our 11–16 Maths 5-year

curriculum encompassing our KS3 Maths Progress and Edexcel GCSE (9–1) Mathematics courses. The interactive scheme of work will be totally flexible so you can tailor it to the way you want to plan and deliver your 11-16 maths curriculum.

Summary of componentsl 9 Student Books – three for each year group (7, 8 and 9)

l 9 Progression Workbooks – three for each year group (7, 8 and 9)

l 1 Digital Answer Book (free)

l 1 ActiveLearn Digital Service – annual subscription licence

l 1 ActiveBook institutional licence (hosted on ActiveLearn Digital Service) – annual subscription licence options

l 2 Revise Key Stage 3 Study Guides (Foundation and Higher)

l 2 Revise Key Stage 3 Workbooks (Foundation and Higher)

Good to know?Digital Resources (ActiveLearn Digital Service)

Contains audio

Progression Service available12th

MA

THEM

ATICS

AGES 11–14

17

How does it work?

PlanningEasy-to-use teacher planning materials in ActiveLearn Digital Service include fully editable lesson plans, schemes of work and mapping to former National Curriculum levels. Advice for approaching evidence-based pedagogies such as problem-solving, reasoning, reflection and fluency plus support for tracking student progression. You’ll also find answers to questions in the Student Books.

7.2 Writing ratios

© Pearson Education Ltd 2014. Copying permitted for purchasing institution only. This material is not copyright free. 1

● Use ratio notation. ● Reduce a ratio to its simplest form. ● Reduce a three-part ratio to its simplest form by cancelling.

Objectives Use ratio notation 5c Reduce a ratio to its simplest form 5b Use the unitary method to solve simple word problems involving ratio and direct proportion 5b Reduce a three-part ratio to its simplest form by cancelling 5a

Resources ● 7.2 Answers ● CPD Video 7.2 ● Beads/counters ● Calculators

Key words Ratio, highest common factor, simplifying

Common errors and misconceptions ● Writing a ratio in the wrong order. Resolve using a concrete

activity showing that a ratio of 1 : 4 is not the same as 4 : 1 using coloured counters/beads.

● Not writing a ratio in its simplest form. Resolve by suggesting that students check to see if both numbers are divisible by 2, 3, 5 or 7 (and possibly more prime numbers if necessary).

Literacy objective Structure mathematical working out and explain appropriately.

Confidence Why learn this? For concrete to be strong you need to use the correct ratio of cement, sand and aggregate. Concrete is made from a mix of sand, cement and ballast (gravel/aggregates). When water is added, the cement becomes a paste which sets hard. Ballast is added to increase strength and volume, as cement alone is not strong enough. There are many different types of concrete which use different ratios of ingredients.

Fluency ● Find the HCF of two numbers.

Explore Were there enough toilets at the Glastonbury festival? What is the Glastonbury festival? Where is Glastonbury? For how many days does the festival last? What sorts of toilets are provided at the festival? Are the toilets indoor, outdoor, permanent or temporary? How many people go to the festival each year? What information would you need to answer this question? The information needed to answer the Explore question is given in the Plenary Explore notes below.

Main lesson Warm up

Highlights common errors and misconceptions.

Differentiated Student Books cater for students of all abilities ensuring smooth progression and support for all students. Each unit follows a unique structure, allowing students to:

l Master fundamental knowledge and skills over a series of lessons

l Check their understanding in a short formative assessment, and give an indication of their confidence level in their Student Progression Chart

l Either strengthen their knowledge in areas they have yet to master

OR

l Extend in areas where they feel confident and have performed well in the assessment

l Finally test their progression across the unit. The results can be recorded in their Student Progression Chart.

Sample page from Theta 1 (Year 7 middle attainers) Student Book

221

9.1 Sequences You will learn to: • Recognise, describe and continue number sequences • Generate terms of a sequence using a term-to-term rule • Find missing terms in a sequence.

MASTER ExtendP241

TestP245

CheckP235

StrengthenP237

CO

NF

IDE

NC

E

Why learn this? When an embryo is developing, the numbers of cells it contains form a sequence. Understanding this sequence can help doctors select healthy embryos for IVF treatment.

Fluency • Find the difference

between −10 and −7 • Work out 0.4 + 1.2

Explore Will there be a FIFA World Cup in 2054?

9 Sequences and graphs

Exercise 9.1 1 Count up in threes starting at 14. Stop when you get to 26.

2 Starting at 24, keep halving until you get a mixed number.

3 Count up in fi ves starting at 8. What do you notice?

Worked example a Write down the next three terms in this sequence. 4, 7, 10, …

4, 7, 10, 13, 16, 19

b Write down the fi rst term and the term-to-term rule.

First term is 4. Term-to-term rule is ‘add 3’.

4 Write down the next three terms of each sequence .

a 6, 11, 16, 21, … b 23, 27, 31, 35, …

c 60, 52, 44, … d 3, 3.2, 3.4, …

Wa

rm u

p

Key point A number sequence is a set of numbers that follow a rule. Each number in a sequence is called a term .

Work out how to get from one term to the next. Continue the pattern for the next three terms.

4 7 10

+3 +3

Write down the fi rst term and the rule to get from one term to the next.

Key point The term-to-term rule tells you how to get from one term to the next in a sequence. It can use adding, subtracting, multiplying and dividing.

Topic links: Decimals, Negative numbers, Fractions Subject links: Science (Q10)

Class teaching and learning: tostretch,challengeandsupportActiveLearn Digital Service helps you make the most of your classroom time with high-quality interactive front-of-class resources and useful assessment materials.

Lesson plan from ActiveLearn Digital Service

www.pearsonglobalschools.com/ks3mathsprogress

18

Home learningActiveLearn Digital Service includes auto-marked online homework and support to give students extra practice and a chance to reflect on their learning. The write-on Progression Workbooks also offer extra practice of key content along with dynamic student support, confidence checkers and progression charts.

If you like this you may also like...Edexcel GCSE (9–1) Mathematics, developed by the KS3 Maths Progress team, takes an innovative mastery approach to tackle the increase in demand of the new GCSE (9–1) Mathematics qualification. Find out more on pages 24–25. iLowerSecondary our new complete programme based on the latest English National Curriculum (2014), but designed with a global outlook, for children aged 11 to 14 – see pages 50-51.

Sample page from Theta 1 (Year 7 middle attainers) Student Book

Screen from ActiveLearn Digital Service

245

1 Write down the next term in each of these sequences. a 0, 50, 100, 150, … b 17, 15, 13, 11, … c 1, 10, 100, 1000, …

2 Write down the term-to-term rule and the next three terms for each of these sequences. a 100, 90, 80, 70, … b 40, 52, 64, 76, … c 8, 9.5, 11, 12.5, … d 1_2 , 1_4 , 1_8 , 1 __ 16 , …

3 Write down the missing numbers in these sequences. a ___ , 7, ___, 17, 22, ___ b ___, 3, 6, 12, 24, ___

4 Sushma makes a bracelet from beads.

It grows like this.

a Copy and complete this table.

Number of fl owers 1 2 3 4 5

Number of beads 5 9

b Describe the term-to-term rule of the sequence.

5 Write down the coordinates of points A, B, C and D.

0

22

2122 21 1 2 3 4

C

A

B

D

5

1

2

3

4

y

x

6 Jemima generates this table of coordinates from an experiment.

x 1 2 3 4 5

y 3 3 3 3 3

a Copy this grid and plot the coordinate pairs.

0 1 2 3 4 5 6

1

2

3

4

5

6

y

x b Draw a line through the points. What is the equation of the line? c Copy and complete this sentence.

When x = 50, the y -coordinate is ___.

TEST ExtendP241

MasterP221

CheckP235

9 Unit test Log how you did on your Student Progression Chart.

StrengthenP237

Assessment and progressionAdditional assessments for each of the Pi, Theta and Delta Student Books are provided on ActiveLearn Digital Service including:

l half-term tests for each Student Book

l end-of-term tests

l end-of-year tests to check progress before moving on

l mark schemes to enable progress logging in Class progression charts

l baseline tests at the start of Year 7 and the end of Year 9 to help with setting for KS3 and GCSE.

MA

THEM

ATICS

AGES 11–14

19

HOW TO SAMPLEEvaluate KS3 Maths Progress with a free 60-day trial of ActiveLearn Digital Service (includes access to teacher planning materials, front-of-class teaching resources, homework and practice support and progression and assessment materials), go to www.pearsonglobalschools.com/ALDStrial, select the programmes you would like to sample and complete your details on the form. Please allow 7 UK working days for the trial to be set-up.

KS3 MATHS PROGRESSTo place an order for ActiveLearn Digital Service and ActiveBook SubscriptionsStep 1: Identify which tier your school size matches. Small school is fewer than 100 pupils, Medium school is 101-300 pupils Large school is 301-500 pupils, Extra Large school is 501-999 pupils Super school is 1000+ pupilsStep 2: Select the ISBNs you want access to. These can be found under the component section of each product page.Step 3: Complete the International digital subscription order form at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.Pi - Lower attainers (levels 3-5), Theta - Middle attainers (levels 4-6) Delta - Higher attainers (levels 5-8)

ACTIVELEARNDIGITALSERVICEKS3 Maths Progress ActiveLearn Digital Service Subscription, INTERNATIONAL SMALL

978 1 292138 56 5

KS3 Maths Progress ActiveLearn Digital Service Subscription, INTERNATIONAL MEDIUM

978 1 292138 57 2

KS3 Maths Progress ActiveLearn Digital Service Subscription, INTERNATIONAL LARGE

978 1 292138 58 9

KS3 Maths Progress ActiveLearn Digital Service Subscription, INTERNATIONAL EXTRA LARGE

978 1 292138 59 6

KS3 Maths Progress ActiveLearn Digital Service Subscription, INTERNATIONAL SUPER

978 1 292138 60 2

ACTIVEBOOKBUNDLESUBSCRIPTIONSKS3 Maths Progress ActiveBooks Bundle Subscription, INTERNATIONAL SMALL

978 1 292135 90 8

KS3 Maths Progress ActiveBooks Bundle Subscription, INTERNATIONAL MEDIUM

978 1 292135 89 2

KS3 Maths Progress ActiveBooks Bundle Subscription, INTERNATIONAL LARGE

978 1 292135 88 5

KS3 Maths Progress ActiveBooks Bundle Subscription, INTERNATIONAL EXTRA LARGE

978 1 292135 87 8

KS3 Maths Progress ActiveBooks Bundle Subscription, INTERNATIONAL SUPER

978 1 292135 91 5

STUDENTBOOKS1–YEAR7(AGES11-12)STUDENTBOOK1(PAPERBACK)KS3 Maths Progress Student Book Pi 1 978 1 447962 29 8KS3 Maths Progress Student Book Theta 1 978 1 447962 32 8KS3 Maths Progress Student Book Delta 1 978 1 447962 31 1

STUDENTBOOKS2–YEAR8(AGES12-13)STUDENTBOOK(PAPERBACK)KS3 Maths Progress Student Book Pi 2 978 1 447962 33 5KS3 Maths Progress Student Book Theta 2 978 1 447962 34 2KS3 Maths Progress Student Book Delta 2 978 1 447962 35 9

STUDENTBOOKS3–YEAR9(AGES13-14)STUDENTBOOK(PAPERBACK)KS3 Maths Progress Student Book Pi 3 978 1 447962 36 6KS3 Maths Progress Student Book Theta 3 978 1 447962 37 3KS3 Maths Progress Student Book Delta 3 978 1 447962 38 0

PROGRESSIONWORKBOOKSYEAR7(AGES11-12)KS3 Maths Progress Progression Workbook Pi 1 8 Pack

978 1 447971 20 7

KS3 Maths Progress Progression Workbook Theta 1 8 Pack

978 1 447971 18 4

KS3 Maths Progress Progression Workbook Delta 1 8 Pack

978 1 447971 19 1

YEAR8(AGES12-13)KS3 Maths Progress Progression Workbook Pi 2 8 Pack

978 1 447971 23 8


978 1 447971 21 4


978 1 447971 22 1

YEAR 9 (AGES 13-14)KS3 Maths Progress Progression Workbook Pi 3 8 Pack

978 1 447971 26 9


978 1 447971 24 5


978 1 447971 25 2

REVISEKS3MATHSFoundation Study Guide 978 1 292111 54 4Foundation Workbook 978 1 292111 52 0Higher Study Guide 978 1 292111 53 7Higher Workbook 978 1 292111 50 6

PEARSON PROGRESSION SERVICESOur progression tools and resources are integrated into our ActiveLearn Digital Service. You can also use Pearson Progression Services alongside your own method, for a whole subject (11-16) or for the whole school across multiple subjects. We have a wide range of purchase options available. For more details, ISBNs and prices, visit www.pearsonglobalschools.com/progression services.

KS3 Maths Progress and mastery:Mastering mathematics involves all students achieving a true depth of understanding of mathematical concepts. Our UK-built approach to teaching for mastery underpins our 11–16 schemes, KS3 Maths Progress and Edexcel GCSE (9–1) Mathematics. It encompasses:l a unique unit structurel mastery depth and breadthl an evidence-based focus on fluency, problem-solving and

reasoning.

The key to success in KS3 mathematics

www.pearsonglobalschools.com/KS3MathsProgress

Why nurturing confidence raises achievement

The thinking behind

10 key principles of

NEW for the 2014 UK National Curriculum

www.pearsonglobalschools.com/ks3mathsprogress

20

Edexcel International GCSE (9–1) Mathematics

Developed for the new Edexcel International GCSE (9–1) specification, these completely new resources have progression, international relevance and support at their core. They provide comprehensive coverage of the specification and the best preparation possible for the examination.

Is it for me?l Specifically developed for international learners, with

appropriate international content, making it engaging and relevant for all learners and allowing for learning in a local context, to a global standard.

l Written by highly experienced authors, David Turner, Ian Potts (Maths A Books 1 and 2 ), and Ali Datoo (Further Pure Maths).

l The new 9–1 grading scale ensures a consistent international standard of qualification. The increase in levels of grading allows learners to achieve their full potential and make more informed decisions about their options for progression.

l Each Student Book provides 3 years access to an ActiveBook, a digital version of the Student Book, which can be accessed online, anytime, anywhere supporting learning beyond the classroom.

l The ActiveLearn Digital Service (for Mathematics A) brings together planning, teaching and assessment materials across one service, saving you valuable time. Together with its interactive activities, it creates a personalised teaching and independent learning experience both in and outside the classroom.

l The embedded transferable skills, needed for progression to higher education and employment, are signposted so students understand, and can engage with, the skills they’re gaining.

l Reviewed by a language specialist to ensure the book is written in a clear and accessible style, and including glossaries of specialist Maths vocabulary.

l Pearson Progression tools allow quick and easy formative assessment of student progress, linked to guidance on how to personalise learning solutions (Mathematics A only).

Good to know?Digital Resources (ActiveLearn Digital Service for Mathematics A) and 3-year access to an ActiveBook with all Student Books.

Together, Mathematics A Books 1 and 2 provide comprehensive coverage of the Higher specification.


MA

THEM

ATICS

AGES 14–16

21www.pearsonglobalschools.com/internationalgcse

Summary of componentsl Mathematics A Student Book 1 and ActiveBook

l Mathematics A Student Book 2 and ActiveBook

l Mathematics A ActiveLearn Digital Service and Online Teacher Resource Pack

l Further Pure Mathematics Student Book and ActiveBook

l Further Pure Mathematics Online Teacher Resource Pack

How does it work?

Online TRPs and ALDS (Maths A).The Teacher Resource Pack is a one-stop-shop for planning and teaching resources, and includes extra materials such as self-assessment sheets for students. All course content is covered by lesson plans, which include the examination Specification reference (Foundation or Higher Tier for Mathematics A). These are all referred to in our course-specific Scheme of Work to help you plan your teaching year.

The Teacher’s ActiveBook (for Mathematics A only) has full front-of-class functionality and includes a wealth of supporting resources.

The The ActiveLearn Digital Service (for Mathematics A) provides a range of planning, teaching, tracking and assessment materials to save you time and help you check that all your students are on track for the exam.

l Lesson plans give you everything you need to successfully deliver the content required

l Prior knowledge worksheets help assess students’ understanding of key topics

l Starter activities help introduce and explain new concepts while engaging students from the start.

l Over 200 videos and animations bring Maths to life, and can be used for presentations, reinforcement or to demonstrate worked solutions.

l Visual reinforcement of worked solutions with hints and guidance about common errors helps consolidate students’ understanding of topics and skills.

l The ActiveLearn course activities can be assigned for students to complete in their own time.

l Progress reports can be used to track the performance of your class, and will highlight particular student difficulties or achievements.

EDEXCEL INTERNATIONAL GCSE (9 –1)

MATHEMATICS AStudent Book 2: Teacher Resource Pack 2 CONTENTS

UNIT 6 . . . . . . . . . . . . . . . . . . . . . . . . PAGE 1

UNIT 7 . . . . . . . . . . . . . . . . . . . . . . . . PAGE 2

UNIT 8 . . . . . . . . . . . . . . . . . . . . . . . . PAGE 3

UNIT 9 . . . . . . . . . . . . . . . . . . . . . . . . PAGE 4

UNIT 10 . . . . . . . . . . . . . . . . . . . . . . PAGE 5

Scheme of Work

• Resources follow the teaching order of Student Book 2.

• Easy-to-follow lesson plans save you valuable planning time.

• Prior knowledge worksheets help you anticipate students’ needs.

• Suggestions for starter activities to ensure well-rounded lessons.

• Progression assessment charts help you monitor and track students’ performance, and assess areas for review. These can be used in conjunction with Pearson 11–16 GCSE Maths Progression Scale.

NEWMaths A Revision guide and App

Providing students with everything they need for exam preparation with topic summaries, worked examples, exam style practice and hints. The app supports ‘on the go’ learning, with video content and enhanced features for note-taking.

22

ALGEBRA 1UNIT 1 19

LEARNING OBJECTIVES

BASIC PRINCIPLES

ACTIVITY 1

ALGEBRA 1

Algebra may have begun in Egypt. The ancient Egyptians used the word ‘aha’, meaning ‘heap’, to stand for an unknown number. In the same way, we use a letter, such as x, today. The Ahmes Papyrus from Ancient Egypt around 1650BC contains problems that need a form of algebra to solve. They are believed to have been set as exercises for young mathematicians. These mathematical skills were probably essential for building the pyramids.

• Simplify algebraic expressions • Expand brackets • Solve equations in which the unknown appears on both sides

• Algebra uses letters, often x, to stand for numbers.

• Algebraic expressions can be treated in the same way as number expressions.

• x + 3 means add three to the unknown number.

• 3x means 3 times the unknown number.

• x2 means square the unknown number.

SKILL: PROBLEM SOLVING Think of a number. Add 7 and then double the answer. Subtract 10, halve the result, and then subtract the original number.

Algebra can show you why the answer is always 2.

Think of a number: xAdd 7: x + 7Double the result: 2x + 14Subtract 10: 2x + 4Halve the result: x + 2Subtract the original number: 2

Make two magic number tricks of your own, one like the example above and another that is longer. Check that they work using algebra. Then test them on a friend.

• Think of a number. Double it, add 12, halve the result, and then subtract the original number. Use algebra to find the answer. If you add a number other than 12, the answer will change. Work out the connection between

the number you add and the answer.

ALGEBRA 2UNIT 2 117

EXERCISE 4*

EXERCISE 4

EXAMPLE 12

KEY POINT

1 2 3 4 5 6 7 8 9 10 11 12

1 2 3 4 5 6 7 8 9 10 11 12

1 2 3 4 5 6 7 8 9 10 11 12

Solve these equations.

Solve these equations.

1 ▶ 4x2 + 26 = 126

2 ▶

x2

73 = 4

3 ▶

x2 117

= 10

4 ▶

1 ▶ 4x2 = 36

2 ▶

x2

3= 12

3 ▶ x2 +5 = 21

4 ▶

x2

2+5 = 37

5 ▶

x 34

+5 = 6

6 ▶

40 2x2

2= 4

7 ▶ 22 = 32

2x2

5

8 ▶ 3 + x( )2 = 169

5 ▶ 2x2 +5 = 23

6 ▶ 5x2 7 = 2

7 ▶

x +125

= 5

8 ▶

x2 + 45

= 4

9 ▶

3x2 +52

+ 4 = 8

10 ▶

3 +

4 + x + 3( )26

= 3

9 ▶ x + 27 = 31

10 ▶ 4 x + 4 = 40

Solve

x +53

= 1.

x +53

= 1 (Multiply both sides by 3)

(Square both sides)

x + 5 = 9 (Subtract 5 from both sides)

x = 4

Check:

4 +53

= 1

• To solve equations, do the same operations to both sides.

x +5 = 3

1= x + 4

2

M02_IGMA_SB_1444_U02.indd 117 04/07/2016 16:14

Unc

orre

cted

pro

of, a

ll co

nten

t sub

ject

to c

hang

e at

pub

lishe

r dis

cret

ion.

Not

for r

esal

e, c

ircul

atio

n or

dis

tribu

tion

in w

hole

or i

n pa

rt. ©

Pea

rson

201

7

Student Books Points of interest put learning in a real-world, international context, making it engaging and relevant for all learners, to a global standard.

Learning objectives provide a clear focus for each lesson.

Assumed knowledge and key concepts are outlined in basic principles.

Key points summarise the essentials.

A variety of activities, questions and worked examples provide the basis for engaging lessons.

Transferable skills, needed for progression into higher education and employment, are embedded throughout and explicitly signposted, allowing students to understand, and engage with, the skills they’re gaining.

Progression icons indicate the level of difficulty and help students reach their potential.

Questions are differentiated, with starred exercises being more advanced than non-starred exercises. More difficult questions, highlighted in green, at the end of some exercises, further challenge more able students.

MA

THEM

ATICS

AGES 14–16


EXAM PRACTICE UNIT 130

1

2

3

4

5

6

7

8

9

10

11

12

13

2x5x – 50

A B80 – x

4x – 3

3x

9 – 2x

EXAM PRACTICE: ALGEBRA 1In questions 1–5, simplify as much as possible.

3yx – 6xy [1]

5ab3 – 4ab2 + 2b2a – 2b3a [1]

4b2 × 2b4 [1]

4p × (2p)3 [1]

9x – (2y – x) [2]

In questions 6–10, solve for x.

=336x

[2]

=36

3x

[2]

8(5 – 2x) = 24 [2]

3x + 5 = 29 – 9x [2]

2(x – 2) – (x – 3) = 3 [2]

The sum of three consecutive numbers is 219. What are the numbers? [3]

Q11 HINT Let the first number be x.

If AB is a straight line, find x and the size of each angle. [3]

The diagram shows an isosceles triangle. Find the value of x and the perimeter of the triangle. [3]

[Total 25 marks]

Sample pages taken from Edexcel International GCSE (9–1) Mathematics A Book 1

CHAPTER SUMMARYUNIT 1 31

CHAPTER SUMMARY: ALGEBRA 1SIMPLIFYING ALGEBRAIC EXPRESSIONS

You can only add or subtract like terms:

2xy + 5xy = 7xy but the terms in 2xy + y cannot be added together;

2x2 + 4x2 = 6x2 but the terms in 2x2 + 3x cannot be added together.

The multiplication sign is often not included between letters, e.g. 2xy means 2 × x × y.

When multiplying, add like powers. 2xy2 × 3x × x2y3 = 6x4y5 (think of x as x1).

You can check your simplifications by substituting numbers.

SIMPLIFYING ALGEBRAIC EXPRESSIONS WITH BRACKETS

To solve equations, always do the same to both sides.

Always check your answer.

The six basic types:

• x + 2 = 10 (Subtract 2 from both sides) x = 8 (Check: 8 + 2 = 10)

• x – 2 = 10 (Add 2 to both sides) x = 12 (Check: 12 – 2 = 10)

• 2 – x = 10 (Add x to both sides) 2 = 10 + x (Subtract 10 from both sides) 2 – 10 = x x = –8 (Check: 2 – (–8) = 10)

• 2x = 10 (Divide both sides by 2) x = 5 (Check: 2 × 5 = 10)

• = 102x

(Multiply both sides by 2) x = 20 (Check: =20

210 )

• =

210

x (Multiply both sides by x)

2 = 10x (Divide both sides by 10) =1

5x (Check: 2 ÷ = 2 × 5 = 10)

Let the unknown quantity be x. Write down the facts in the form of an equation and then solve it.

SOLVING EQUATIONS

PROBLEMS LEADING TO EQUATIONS

Multiply each term inside the bracket by the term outside the bracket.

The multiplication sign is usually not included: 2(a + b) means 2 × (a + b) = 2 × a + 2 × b = 2a + 2b

Be very careful with negative signs outside a bracket: –3(x – 2) means –3 × (x – 2) = (–3) × (x) + (–3) × (–2) = –3x + 6

When multiplying, the number 1 is usually not included: –(3x – 4) means –1 × (3x – 4) = (–1) × (3x) + (–1) × (–4) = –3x + 4

HOW TO SAMPLEEvaluating this series is easy and with instant access to online samples of the Student Books which are available at www.pearsonglobalschools.com/internationalgcse.

If you like this, you may also like...Resources for the Edexcel International A Level (IAL) in Mathematics (see page 28–31). Edexcel International GCSE (9–1) is available for a range of subjects (see page 10).

Exam practice tests cover the whole chapter and provide quick, effective feedback on students’ progress.

Chapter summaries state the most important points in each chapter and aid revision.

EDEXCEL INTERNATIONAL GCSE (9–1)To place an order for ActiveLearn Digital ServiceStep 1: Identify which tier your school size matches. Small school is fewer than 100 pupils Medium school is 101–300 pupils Large school is 301–500 pupils Extra Large school is 501–999 pupils Super school is 1000+ pupilsStep 2: Select the ISBNs you want access to. These can be found under the component section of each product page.Step 3: Complete the International digital subscription order form at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

MATHEMATICSAEdexcel International GCSE Mathematics A Student Book 1

978 0 435181 44 4

Edexcel International GCSE Mathematics A Student Book 2

978 0 435183 05 9

Edexcel International GCSE (9–1) Mathematics A Digital Subscription: Small

978 0 435183 09 7

Edexcel International GCSE (9–1) Mathematics A Digital Subscription: Medium

978 0 435183 08 0

Edexcel International GCSE (9–1) Mathematics A Digital Subscription: Large

978 0 435183 07 3

Edexcel International GCSE (9–1) Mathematics A Digital Subscription: Extra Large

978 0 435183 06 6

Edexcel International GCSE (9–1) Mathematics A Digital Subscription: Super

978 0 435183 11 0

FURTHERPUREMATHEMATICSEdexcel International GCSE (9–1) Further Pure Maths Student Book

978 0 435188 54 2

Online Teacher Resource Pack Further Pure Mathematics (Available February 2018)

978 0 435191 21 4

REVISIONMATERIALNEWPearson Edexcel International GCSE Mathematics A Revision Guide and App (Excluding China) . Customers in China please contact your local representative for local version.

978 1 292278 29 2

24

Edexcel GCSE (9–1) Mathematics

Our brand-new resources are written specifically to tackle the increase in demand of the new Edexcel GCSE (9-1) Maths qualification.

Is it for me?l Develops an 11-16 approach to progression

with new ways to track and report your students’ progress in maths - the ideal next step from KS3 Maths Progress.

l Designed to help you teach the new Edexcel GCSE Mathematics (9-1) specification with confidence.

l Builds fluency and nurtures student confidence with a unique, differentiated unit structure.

l Focuses on problem-solving and reasoning throughout.

l Support for your lower attaining students with dedicated Access to Foundation Workbooks to help them master the basics.

What’s special?l A digital interactive scheme of work for our

11–16 Maths 5-year curriculum encompassing our KS3 Maths Progress and Edexcel GCSE (9–1) Mathematics courses. The interactive scheme of work will be totally flexible so you can tailor it to the way you want to plan and deliver your 11–16 maths curriculum.

Summary of componentsl 2 Student Books (Foundation and Higher)

l 2 Access to Foundation Workbooks (Number and Statistics & Geometry)

l 4 Practice, Reasoning and Problem-solving Books (Foundation, Foundation Booster, Higher and Higher Extension)

l 1 Digital Answer Book (free)

l 8 Intervention Workbooks

l 1 ActiveLearn Digital Service – annual subscription licence

l 2 ActiveBook institutional licences (Foundation and Higher), hosted on ActiveLearn Digital Service – annual subscription licence

l 2 Revise GCSE (9–1) Mathematics Study Guides (Foundation and Higher)

l 2 Revise GCSE (9–1) Mathematics Workbooks (Foundation and Higher)


Contains audio


MA

THEM

ATICS

AGES 14–16

25www.pearsonglobalschools.com/gcsemaths

HOW TO SAMPLEEvaluate with a free 60-day trial of ActiveLearn Digital Service (includes access to the Teacher Guide, ActiveBook and the Homework Practice and Support Service), go to www.pearsonglobalschools.com/ALDStrial select the programmes you would like to sample and complete your details on the form. Please allow 7 UK working days for the trial to be set-up.

EDEXCEL GCSE (9–1) MATHEMATICSTo place an order for ActiveLearn Digital Service (ALDS) and ActiveBook Subscriptions:Step 1: Identify which tier your school size matches. Small school is fewer than 100 pupils Medium school is 101-300 pupils Large school is 301-500 pupils Extra Large school is 501-999 pupils Super school is 1000+ pupilsStep 2: Select the ISBNs you want access to. These can be found under the component section of each product page.Step 3: Complete the International digital subscription order form at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

ACTIVELEARNDIGITALSERVICEEdexcel GCSE (9-1) Mathematics ActiveLearn Digital Service Subscription, INTERNATIONAL SMALL

978 1292115 14 6

Edexcel GCSE (9-1) Mathematics ActiveLearn Digital Service Subscription, INTERNATIONAL MEDIUM

978 1292115 13 9

Edexcel GCSE (9-1) Mathematics ActiveLearn Digital Service Subscription, INTERNATIONAL LARGE

978 1292115 12 2

Edexcel GCSE (9-1) Mathematics ActiveLearn Digital ServiceSubscription, INTERNATIONAL EXTRA LARGE

978 1292115 11 5

Edexcel GCSE (9-1) Mathematics ActiveLearn Digital Service Subscription, INTERNATIONAL SUPER

978 1292115 15 3

STUDENTBOOK(PAPERBACK)Edexcel GCSE (9-1) Mathematics: Foundation Student Book

978 1447980 19 3

Edexcel GCSE (9-1) Mathematics: Higher Student Book

978 1447980 20 9

ACCESSTOFOUNDATIONWORKBOOK(PAPERBACK)Edexcel GCSE (9-1) Mathematics – Access to Foundation Workbook: Number (Pack of 8)

978 1447985 51 8

Edexcel GCSE (9-1) Mathematics – Access to Foundation Workbook: Statistics & Geometry (Pack of 8)

978 1447999 80 5

ACTIVEBOOKSUBSCRIPTIONSFOUNDATIONACTIVEBOOKSUBSCRIPTIONEdexcel GCSE (9-1) Mathematics Foundation ActiveBook Subscription, INTERNATIONAL SMALL

978 1292115 04 7

Edexcel GCSE (9-1) Mathematics Foundation ActiveBook Subscription, INTERNATIONAL MEDIUM

978 1292115 03 0

Edexcel GCSE (9-1) Mathematics Foundation ActiveBook Subscription, INTERNATIONAL LARGE

978 1292115 02 3

Edexcel GCSE (9-1) Mathematics Foundation ActiveBook Subscription, INTERNATIONAL EXTRA LARGE

978 1292115 01 6

Edexcel GCSE (9-1) Mathematics Foundation ActiveBook Subscription, INTERNATIONAL SUPER

978 1292115 05 4

HIGHERACTIVEBOOKSUBSCRIPTIONEdexcel GCSE (9-1) Mathematics Higher ActiveBook Subscription, INTERNATIONAL SMALL

978 1292115 09 2

Edexcel GCSE (9-1) Mathematics Higher ActiveBook Subscription, INTERNATIONAL MEDIUM

978 1292115 08 5

Edexcel GCSE (9-1) Mathematics Higher ActiveBook Subscription, INTERNATIONAL LARGE

978 1292115 07 8

Edexcel GCSE (9-1) Mathematics Higher ActiveBook Subscription, INTERNATIONAL EXTRA LARGE

978 1292115 06 1

Edexcel GCSE (9-1) Mathematics Higher ActiveBook Subscription, INTERNATIONAL SUPER

978 1292115 10 8

PRACTICEREASONINGANDPROBLEMSOLVINGBOOKS Edexcel GCSE (9-1) Mathematics: Foundation Booster Practice, Reasoning and Problem-solving Book

978 1292100 17 3

Edexcel GCSE (9-1) Mathematics: Higher Extension Practice, Reasoning and Problem-solving Book

978 1292105 05 5

Edexcel GCSE (9-1) Mathematics: Foundation Practice, Reasoning and Problem-solving Book

978 1447983 59 0

Edexcel GCSE (9-1) Mathematics: Higher Practice, Reasoning and Problem-solving Book

978 1447983 60 6

INTERVENTIONWORKBOOKSTARGET GRADE 3Algebra and Shape Workbook 978 0 435183 31 8Number and Statistics Workbook 978 0 435183 32 5TARGET GRADE 5Number and Algebra Workbook 978 0 435183 33 2Shape and Statistics Workbook 978 0 435183 34 9TARGET GRADE 7Algebra and Shape Workbook 978 0 435183 35 6Number and Statistics Workbook 978 0 435183 36 3TARGET GRADE 9Algebra Workbook 978 0 435183 37 0 Algebraic techniques, Shape and Statistics Workbook

978 0 435183 38 7


If you like this you may also like...Edexcel GCSE (9–1) Statistics see page 26.

KS3 Maths Progress is developed by the same team and follows the same approach and unit structure as Edexcel GCSE (9–1) Mathematics to provide you and your students with seamless progression to GCSE. Find out more on pages 16–19.

26

Edexcel GCSE (9-1) Statistics

Developed in line with the key principles of the new specification, our brand new Edexcel GCSE (9-1) statistics will develop confident statisticians.

Is it for me?l Gives you comprehensive and accessible

support – designed to help you deliver the new Edexcel GCSE (9-1) Statistics specification with confidence.

l Includes engaging opportunities to work with authentic data – plenty of real-life statistics in every unit to bring the subject to life and highlight important applications.

l Supports progression – underpinned by Pearson Progression Services to help you understand and monitor the progress of your students.

l Fully aligned with Edexcel’s scheme of work – with mappings to GCSE Maths to help you plan, whichever delivery route you choose.

l Helps students prepare for the new linear exams – includes more support for exam preparation than ever before.

l Supports both Foundation and Higher students.

Good to know?Annual ActiveBook subscriptions provide online access to a digital version of the the Student Book.

EDEXCEL GCSE (9-1) STATISTICSTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

STUDENTRESOURCESEdexcel GCSE (9-1) Statistics Student Book 978 1292190 31 0Revise Edexcel GCSE (9-1) Statistics Revision Guide

978 1292191 62 1

Revise Edexcel GCSE (9-1) Statistics Revision Guide Workbook (Available June 2018)

978 1 292191 6 1 4

ACTIVEBOOKSUBSCRIPTIONSEdexcel GCSE (9-1) Statistics ActiveBook INTERNATIONAL Small

978 1292232 77 5

Edexcel GCSE (9-1) Statistics ActiveBook INTERNATIONAL Medium

978 1292232 76 8

Edexcel GCSE (9-1) Statistics ActiveBook INTERNATIONAL Large

978 1292232 75 1

Edexcel GCSE (9-1) Statistics ActiveBook INTERNATIONAL Extra Large

978 1292232 79 9

Edexcel GCSE (9-1) Statistics ActiveBook INTERNATIONAL Super

978 1292232 78 2

MA

THEM

ATICS

AGES 14–18


Edexcel Core Maths: Maths in Context

Real-world Mathematical problem solving for Edexcel Level 3

Is it for me?l Teach the content that you need for

the specification - Maths in Context is the only course written for the Edexcel Mathematics in Context specification and follows the Scheme of Work.

l Motivate students to solve problems using maths - Themes are relevant to adult-life and questions interrogate scenarios mathematically to help embed learning for future education or career paths.

l Saves you time planning - All the material you need to teach each topic in the specification, with real-life data sources and relevant mathematical questions written by experts.

l Supports independent learning - Content designed around a pedagogy to support independent learning, giving hints and guidance when students might need it.

Good to know?Each Student Book provides 3-year access to an eBook.

EDEXCEL CORE MATHS: MATHS IN CONTEXTTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

STUDENTRESOURCESEdexcel Maths in Context Project Book + eBook 978 1292149 28 8

28

Edexcel International A Level (IAL) Mathematics

Developed for the new International A Level specification, these new resources are specifically designed for international students, with a strong focus on progression, recognition and transferable skills, allowing learning in a local context to a global standard.

Is it for me?l Recognised by universities worldwide and fully

comparable to UK reformed GCE A levels.

l Supports a modular approach, in line with the specification.

l Appropriate international content puts learning in a real-world context, to a global standard, making it engaging and relevant for all learners.

l The embedded transferable skills, needed for progression to higher education and employment, are signposted so students understand what skills they are developing and therefore go on to use these skills more effectively in the future.

l Exam practice provides opportunities to assess understanding and progress, so students can make the best progress they can.

l Accompanying Online Teacher Resource Packs (TRP) contain material such as lesson plans, worksheets, and slide decks to support your planning and teaching and save you valuable time.

What’s new?l These are brand new resources to support the

updated Edexcel International Advanced Level (IAL) in Mathematics, for first teaching from September 2018.

NEW

Good to know?Each Student Book comes with 3-years access to an online ActiveBook. The ActiveBook can also be purchased as a standalone (3-years access). The online Teacher Resource Packs are available as an annual subscription.


MA

THEM

ATICS

AGES 16–18


How does it work?

Planning Matched to the new 2018 specificationsThese new resources are written specifically to offer a complete match to the content, structure and modular approach of the new 2018 specifications. Offering support to a qualification that is fully comparable to the reformed UK GCE A levels, and recognised as equal to the GCE by universities worldwide.

Better support for youThe online teacher resources provide a range of planning, teaching and assessment resources, saving you valuable time.

Teaching and learningInternationally appropriate contentAppropriate international content puts learning in a real-world context, to a global standard, and includes a range of relevant contexts, photos, examples and currencies – making it engaging and relevant for all learners. Language is reviewed by a specialist to ensure materials are written in a clear and accessible style.

1CHAPTER 1ALGEBRAIC EXPRESSIONS

1 ALGEBRAICEXPRESSIONSA�er completing this chapter you should be able to:

● Multiply and divide integer powers → pages 2–3

● Expand a single term over brackets and collect like terms → pages 2–4

● Expand the product of two or three expressions → pages 4–6

● Factorise linear, quadratic and simple cubic expressions → pages 6–9

● Know and use the laws of indices → pages 9–11

● Simplify and use the rules of surds → pages 12–13

● Rationalise denominators → pages 13–15

1 Simplify:

a 4m2n + 5mn2 – 2m2n + mn2 – 3mn2

b 3x2 – 5x + 2 + 3x2 – 7x – 12 ← International GCSE Mathematics

2 Write as a single power of 2:

a 25 × 23 b 26 ÷ 22

c (23)2 ← International GCSE Mathematics

3 Expand:

a 3(x + 4) b 5(2 – 3x)

c 6(2x – 5y) ← International GCSE Mathematics

4 Write down the highest common factor of:

a 24 and 16 b 6x and 8x2

c 4xy2 and 3xy ← International GCSE Mathematics

5 Simplify:

a 10x ____ 5

b 20x ____ 2

c 40x ____ 24

← International GCSE Mathematics

Computer scientists use indices to describe very large numbers. A quantum computer with 1000 qubits (quantum bits) can consider 21000 values simultaneously. This is greater than the number of particles in the observable universe.

Learning objectives

Prior knowledge check

1.11.21.10

Sample page from Edexcel International A Level Pure Mathematics 1 Student Book

Learning Objectives at the beginning of each section/chapter highlight what students need to know and understand, and refer to the specification requirements.

Links to the real world use of the content being covered helps put learning in context.

30

37CHAPTER 9 CONSTANT ACCELERATION

9.3 Constant acceleration formulae 1

A standard set of letters is used for the motion of an object moving in a straight line with constant acceleration.

• s is the displacement.

• u is the initial velocity.

• v is the final velocity.

• a is the acceleration.

• t is the time.

You can use these letters to label a velocity–time graph representing the motion of a particle moving in a straight line accelerating from velocity u at time 0 to velocity v at time t.

v – u

u

O

v

t Time

Velocity

Initialvelocity

Constantacceleration

Initial position Position a�er t seconds

Velocity a�ert seconds

u a

s

v

Shaded area = ( u + v _____ 2

) t

s = ( u + v _____ 2

) t 2

• v = u + at 1

• s = ( u + v _____ 2

) t 2

You need to know how to derive these formulae from the velocity–time graph.

Formula 1 does not involve s and formula 2 does not involve a.

Hint

These formulae can also be derived using calculus. → Chapter 11

Links

Gradient of line = v − u _____ t

a = v − u _____ t

Rearranging v = u + at 1

A cyclist is travelling along a straight road. She accelerates at a constant rate from a velocity of 4 m s21 to a velocity of 7.5 m s21 in 40 seconds. Find:a the distance she travels in these 40 secondsb her acceleration in these 40 seconds.

Example 4

4 m s–1 7.5 m s–1

s

u = 4, v = 7.5, t = 40, s = ?, a = ?

Start by drawing a diagram.

Model the cyclist as a particle.

Write down the values you know and the values you need to find.

Sample page from Edexcel International A Level Mechanics 1 Student Book

Assessment Lots of exam practiceExam practice provides opportunities to assess understanding and progress, so students can make the best progress they can.

Signposted transferable skillsTransferable skills, needed for progression into higher education and employment, are embedded throughout the Student Books, and explicitly signposted, so students understand what skills they are developing and therefore go on to use these skills more effectively in the future.

Home learningSupporting learning beyond the classroomEach Student Book provides access to an ActiveBook, which is a digital version of the Student Book, and can be accessed online, anytime, anywhere.

Exam hints draw learners’ attention to potential pitfalls in the exam and give practical hints about preparing for the exams, answering questions in the correct format, and checking work.

Worked examples show how to work through questions, and how to lay out calculations.

MA

THEM

ATICS

AGES 16–18


HOW TO SAMPLEDownload free samples at www.pearsonglobalschools.com/IAL

If you like this you may also like...Edexcel International GCSE (9–1) in Mathematics - see pages 20–23

EDEXCEL INTERNATIONAL A LEVEL (IAL) IN MATHEMATICSTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact. Orders for the Online Teacher Resource Packs need to be accompanied by a digital subscription order form which can be downloaded at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

DECISIONEdexcel International A Level Mathematics Decision 1 Student Book

978 1 292244 56 3

Edexcel International A Level Mathematics Decision 1 Teacher Resource Pack

978 1 292244 57 0

PUREEdexcel International A Level Mathematics Pure 1 Student Book

978 1 292244 79 2

Edexcel International A Level Mathematics Pure 1 Teacher Resource Pack

978 1 292244 83 9

Edexcel International A Level Mathematics Pure 2 Student Book

978 1 292244 85 3

Edexcel International A Level Mathematics Pure 2 Teacher Resource Pack

978 1 292244 90 7

Edexcel International A Level Mathematics Pure 3 Student Book (Available February 2019)

978 1 292244 92 1

Edexcel International A Level Mathematics Pure 3 Teacher Resource Pack (Available April 2019)

978 1 292244 93 8

Edexcel International A Level Mathematics Pure 4 Student Book (Available February 2019)

978 1 292245 12 6

Edexcel International A Level Mathematics Pure 4 Teacher Resource Pack (Available April 2019)

978 1 292245 13 3

FURTHERPUREEdexcel International A Level Mathematics Further Pure 1 Student Book

978 1 292244 64 8

Edexcel International A Level Mathematics Further Pure 1 Teacher Resource Pack (Available February 2019)

978 1 292244 58 7

Edexcel International A Level Mathematics Further Pure 2 Student Book (Available March 2019)

978 1 292244 65 5

Edexcel International A Level Mathematics Further Pure 2 Teacher Resource Pack (Available May 2019)

978 1 292244 62 4

Edexcel International A Level Mathematics Further Pure 3 Student Book (Available March 2019)

978 1 292244 66 2

Edexcel International A Level Mathematics Further Pure 3 Teacher Resource Pack (Available May 2019)

978 1 292244 63 1

MECHANICSEdexcel International A Level Mathematics Mechanics 1 Student Book

978 1 292244 67 9

Edexcel International A Level Mathematics Mechanics 1 Teacher Resource Pack

978 1 292244 68 6

Edexcel International A Level Mathematics Mechanics 2 Student Book

978 1 292244 76 1

Edexcel International A Level Mathematics Mechanics 2 Teacher Resource Pack

978 1 292244 78 5

Edexcel International A Level Mathematics Mechanics 3 Student Book (Available April 2019)

978 1 292244 81 5

Edexcel International A Level Mathematics Mechanics 3 Teacher Resource Pack (Available June 2019)

978 1 292244 82 2

STATISTICSEdexcel International A Level Mathematics Statistics 1 Student Book

978 1 292245 14 0

Edexcel International A Level Mathematics Statistics 1 Teacher Resource Pack

978 1 292245 15 7

Edexcel International A Level Mathematics Statistics 2 Student Book

978 1 292245 17 1


978 1 292245 16 4

Edexcel International A Level Mathematics Statistics 3 Student Book

978 1 292245 18 8


978 1 292245 19 5

32

Edexcel AS and A Level Mathematics and Further Mathematics (2017)

Our Pearson Edexcel AS and A level Mathematics and Further Mathematics resources retain all the features that teachers and students know and trust about the current series, whilst being fully updated to match the new specifications.

Our Pearson Edexcel AS and A level Maths and Further Maths resources are designed to match the new linear exam structure. They provide lots of practice for the new style of questions, so that you and your students are fully prepared for the exams.

Is it for me?l With over 1.3 million copies sold of the previous edition,

Pearson’s maths resources are the market-leading and most trusted resources for AS and A level Mathematics.

l This series covers all the content needed for the Edexcel AS and A Level Mathematics and AS and A Level Further Mathematics exam.

Good to know?ActiveLearn Digital Service combines all the digital content you’ll need into one easy-to-use service.

If you like this you may also like...Edexcel AS and A Level Modular Mathematics for the 2008 specification is a bestselling series. For full details, learn more at www.pearsonglobalschools.com

HOW TO SAMPLEEvaluate ActiveLearn Digital Service with a free 60-day trial. Sign-up at www.pearsonglobalschools.com/ALDStrial.

MA

THEM

ATICS

AGES 16–18


How does it work?

TextbooksOur textbooks have been designed to match the new Edexcel exam structure, with separate Pure and Applied textbooks for AS and A level Maths, and a textbook per option for AS and A level Further Maths.

l Fully updated to match the new specifications, with more of a focus on problem-solving and modelling as well as supporting the large data set and new calculators.

l FREE additional online content to support independent learning, including worked solutions for every question in the textbooks, GeoGebra interactives enabling students to visualise problems and Casio tutorials to support with the new calculator requirements.

l Include access to online digital editions (valid for 3 years once activated).

l Retain all the features that teachers and students know and trust, including worked examples with guidance, lots of exam-style questions, practice papers, and plenty of mixed and review exercises.

ActiveLearn Digital ServiceOur ActiveLearn Digital Service combines online front-of-class teaching resources with planning tools and progression and assessment materials. It also includes student access to e-books of all the Maths and Further Maths textbooks.

The full annual subscription includes:

l Front-of-class e-book versions of the textbooks

l Front-of-class interactive teaching resources

EDEXCEL AS AND A LEVEL MATHEMATICS AND FURTHER MATHEMATICS (2017)To place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

AS/ALEVELMATHEMATICSTEXTBOOKSEdexcel AS and A level Mathematics Pure Mathematics Year 1/AS Textbook + e-book

978 1 292183 39 8

Edexcel AS and A level Mathematics Statistics & Mechanics Year 1/AS Textbook + e-book

978 1 292232 53 9

Edexcel A level Mathematics Pure Mathematics Year 2 Textbook + e-book

978 1 292183 40 4

Edexcel A level Mathematics Statistics & Mechanics Year 2 Textbook + e-book

978 1 446944 07 3

AS/ALEVELFURTHERMATHEMATICSTEXTBOOKSEdexcel AS and A level Further Mathematics Core Pure Mathematics Book 1/AS Textbook + e-book

978 1 292183 33 6

Edexcel A level Further Mathematics Core Pure Mathematics Book 2 Textbook + e-book

978 1 292183 34 3

Edexcel AS and A level Further Mathematics Further Statistics 1 Textbook + e-book

978 1 292183 37 4

Edexcel AS and A level Further Mathematics Further Statistics 2 Textbook + e-book

978 1 292183 38 1

Edexcel AS and A level Further Mathematics Decision Mathematics 1 Textbook + e-book

978 1 292183 29 9

Edexcel AS and A level Further Mathematics Decision Mathematics 2 Textbook + e-book

978 1 292183 30 5

Edexcel AS and A level Further Mathematics Further Mechanics 1 Textbook + e-book

978 1 292183 31 2

Edexcel AS and A level Further Mathematics Further Mechanics 2 Textbook + e-book

978 1 292183 32 9

Edexcel AS and A level Further Mathematics Further Pure Mathematics 1 Textbook + e-book

978 1 292183 35 0

Edexcel AS and A level Further Mathematics Further Pure Mathematics 2 Textbook + e-book

978 1 292183 36 7

ACTIVELEARNDIGITALSERVICEEdexcel AS and A level Mathematics and Further Mathematics ActiveLearn Digital Service Subscription, <100 learners

978 1 292230 40 5

REVISIONRevise Edexcel AS Mathematics (2017) Revision Guide

978 1 292190 66 2

Revise Edexcel AS Mathematics Revision Workbook

978 1 292190 61 7

Revise Edexcel A level Mathematics (2017) Revision Guide

978 1 292190 67 9

Revise Edexcel A level Mathematics Revision Workbook

978 1 292190 60 0

Edexcel AS Mathematics Practice Papers Plus

978 1 292213 27 9

Edexcel A level Mathematics Practice Papers Plus

978 1 292213 26 2

l Progression and assessment materials

l Integration with Edexcel’s free interactive Scheme of Work

l Student access to e-book versions of the textbooks.

Revise EdexcelOur new Revise Edexcel books for AS and A level Maths provide all the exam guidance, hints and tips students will need, as well as plenty of exam practice.

http://www.pearsonglobalschools.com/ALMaths2017

34

Exploring Science: Working Scientifically

Is it for me?l Provides clearly defined and

differentiated Learning Objectives for every lesson. These develop according to our unique progression grids, and allow you to define, secure and measure progression for every lesson.

l Tackles the barriers to progression in GCSE and iGCSE right from the start of Year 7, and follows evidence-based approaches to the teaching of Literacy and Numeracy.

Exploring Science: Working Scientifically, is the comprehensive digital and print service for all your planning, teaching, learning, homework and assessment needs for the new curriculum.



SCIENCE

AGES 11–14

35www.pearsonglobalschools.com/exploringscience

How does it work?

PlanningThe Interactive Scheme of Work in ActiveLearn provides you with a guide for teaching the content, including a suggested teaching order, an idea of when to teach and how long to spend on each topic. As you edit your course the iSow will automatically highlight any prerequisite topics that you need to teach first, saving you time on planning and teaching your lesson. Giving you flexibility and confidence in planning. In addition the Interactive Scheme of Work provides:

l background information for each unit, including explanations of the science and potential misconceptions.

l detailed Technician notes.

l all the answers to all the questions in the Student Books and Activity Packs.

l full mapping of the units to the curriculum and skills coverage, including a Blooms’ Taxonomy for each unit.

Year 7 Student Book Sample

I can … ■ describe the functions of di� erent bones in the skeleton ■ describe some di� erent types of joint.

People who do sport for a living need to get treatment quickly if they are injured. Big football clubs spend millions on building specialist treatment centres to ensure their players get the best possible treatment.

BonesMany people think that bones are not living, but bones are living organs. They grow as you grow and repair themselves if they fracture (break). Bones are hard and strong so that they can stand up to hard knocks and pressure. They are also light so they can be moved easily.

7CcTHE SKELETONWHAT ARE THE FUNCTIONS OF THE SKELETON?

B | Bone-making cells (osteoblasts) can produce bone material in different ways, forming compact bone and spongy bone.

Babies are born with about 270 bones but some of them fuse together as they grow. An adult

has 206 bones.

The smallest bone in the body is the stapes or stirrup bone in the ear. It’s about the size of a grain of rice, and its

function is to transfer sound waves into the inner ear.

A | Common footballing injuries include broken bones and damage to cartilage, tendons and ligaments.

E | X-rays allow us to see bones inside the body. This is an X-ray of a hip, which is a type of fl exible joint called a ‘ball and socket’ joint.

F | An elbow is a type of fl exible joint called a ‘hinge joint’.

cartilage tissueSpongy bone material has manyspaces in it to keepthe whole bone light.

circles of bone produced by bone-making cells called osteoblasts

Compact bone material is very hard and strong, but is also heavy. It is used to form a tube shape, which is a very strong shape.

The inside of a bone is filled with bone marrow tissue. This helps to reduce the mass of the bone (and the bone marrow makes blood cells).

1 a| State two things that osteoblasts need to stay alive.

b| What process do osteoblasts need these things for?

2 Explain why a large bone can be both strong and light.

3 How can you tell that the bone in diagram B is an organ?

SupportThe bones in your body form your skeleton, shown in photo C. Your skeleton makes sure that your body keeps its shape and also supports your body. The backbone is made up of smaller bones called vertebrae and is the human body’s main support.

Some bones help to support organs. For example, your lungs would collapse without your ribs.

4 What do your ribs and sternum form?

5 Give one function of the backbone.

collar bone

forearm bones

knee cap

shin bone

sternumribcage

ribs

skull

upper arm bone

vertebrae (small bones in the back make up the ‘backbone’)

hip

thigh bone

Protection

D

fixed joints don't move

MovementTwo bones next to each other can form a � exible joint. The bones in a � exible joint are moved by muscles, which are attached to the bones by tendons. Ligaments hold the bones in a � exible joint together. The ends of bones in a � exible joint are often covered in a slippery tissue called cartilage, which helps them slide past each other.

Flexible joints can be damaged when playing sports. A sprain occurs when a ligament is stretched or torn. Sprains can cause dislocations, in which bones in a joint move out of line so that the joint doesn’t work. When people ‘pull muscles’, either a muscle or the tendon that connects the muscle to a bone gets a small tear in it.

muscles

cartilage

upper arm bone

forearm bones

tendon

tendon

ligament

6 The nervous system includes the brain and the spinal cord. Your spinal cord is a large bundle of important nerves that runs down your back. Which bones protect:a| your brain b| your spinal cord?

7 Which organs are protected by your ribcage?

Some bones protect organs in the body. For example, the skull protects the brain. The skull is actually made of 22 bones that are joined by � xed joints.

C | a skeleton

8 a| List three di� erent types of joint.b| Which of these joints allows movement in the

most directions?c | What causes the bones to move?

9 Describe the di� erent functions of bones.

10 Look at X-ray E.

a| What bone forms the ‘ball’ in this joint?b| The joint on the right of the X-ray is normal.

What has happened to the joint on the left?c | Suggest how this has occurred.

46 47

Class teaching and learningThe Student Books provide a rich and stimulating learning experience. Packed with extraordinary photos and incredible facts, they encourage all students to explore and to learn. The Activity Packs (available as printed files or downloadable as part of ActiveLearn) support the Student Books with over 1500 differentiated worksheets across all three years of Key Stage 3 (11–14).

36

Video from ActiveLearn Digital Service

Interactive assets and animations developed for front-of-class use, with world-class videos, including stunning BBC and Sky News clips, for a high-impact learning experience.

Home LearningActiveLearn provides online homework for students with instant feedback to aid motivation and powerful reporting to help track progression. The ActiveBooks, a digital version of the Student Book, allows easy access for students.

Assessment and ProgressionAssessment in Exploring Science uses the Pearson Progression Scale allowing you to track progress from 11–16. This includes Year 7 baseline assessments, End of Unit, End of Year, and End of Course assessments.

Sample screen from ActiveLearn Digital Service

Track results and student progress.

SCIENCE

AGES 11–14

37

HOW TO SAMPLEEvaluate Exploring Science: Working Scientifically with a free 60-day trial of ActiveLearn Digital Service. Go to www.pearsonglobalschools.com/ALDStrial, select the programmes you would like to sample and complete your details on the form. Please allow 7 UK working days for the trial to be set-up.

EXPLORING SCIENCE WORKING SCIENTIFICALLYTo place an order for ActiveLearn Digital Service and ActiveBooksStep 1: Identify which tier your school size matches. Small school is fewer than 100 pupils Medium school is 101-300 pupils Large school is 301-500 pupils Extra Large school is 501-999 pupils Super school is 1000+ pupilsStep 2: Select the ISBNs you want access to. These can be found under the component section of each product page.Step 3: Complete the International digital subscription order form at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

ACTIVELEARNDIGITALSERVICEActiveLearn Digital ServiceSubscription, INTERNATIONAL SMALL

978 1 292138 61 9

ActiveLearn Digital Service Subscription, INTERNATIONAL MEDIUM

978 1 292138 62 6

ActiveLearn Digital Service Subscription, INTERNATIONAL LARGE

978 1 292138 63 3

ActiveLearn Digital Service Subscription, INTERNATIONAL EXTRA LARGE

978 1 292138 64 0

ActiveLearn Digital Service Subscription, INTERNATIONAL SUPER

978 1 292138 65 7

ACTIVEBOOKSYEAR7(11-12YEAROLDS)Year 7 Student ActiveBooks Subscription, INTERNATIONAL SMALL

978 1 292138 51 0

Year 7 Student ActiveBooks Subscription, INTERNATIONAL MEDIUM

978 1 292138 52 7

Year 7 Student ActiveBooks Subscription, INTERNATIONAL LARGE

978 1 292138 53 4

Year 7 Student ActiveBooks Subscription, INTERNATIONAL EXTRA LARGE

978 1 292138 54 1

Year 7 Student ActiveBooks Subscription, INTERNATIONAL SUPER

978 1 292138 55 8


978 1 292138 41 1


978 1 292138 47 3


978 1 292138 48 0


978 1 292138 49 7


978 1 292138 50 3


978 1 292138 42 8


978 1 292138 43 5


978 1 292138 44 2


978 1 292138 45 9


978 1 292138 46 6

STUDENTBOOKSStudent Book 7 978 1 447959 60 1Student Book 8 978 1 447959 61 8Student Book 9 978 1 447959 62 5

TEACHERMATERIALSTeacher & Technician Planning Pack 7 978 1 447959 63 2Teacher & Technician Planning Pack 8 978 1 447959 64 9Teacher & Technician Planning Pack 9 978 1 447959 65 6Activity Pack 7 978 1 447959 39 7Activity Pack 8 978 1 447959 40 3Activity Pack 9 978 1 447959 41 0Assessment Support Pack 7 978 1 447959 42 7Assessment Support Pack 8 978 1 447959 43 4Assessment Support Pack 9 978 1 447959 44 1

PEARSON PROGRESSION SERVICESOur progression tools and resources are integrated into our ActiveLearn Digital Service. You can also use Pearson Progression Services alongside your own method, for a whole subject (11–16) or for the whole school across multiple subjects. We have a wide range of purchase options available. For more details, ISBNs and prices, visit www.pearsonglobalschools.com/progression services.

If you like this you may also like...Edexcel GCSE (9–1) Science provides you and your students with seamless progression from Key Stage 3 to GCSE. Find out more on pages 42-43. iLowerSecondary our new complete programme based on the latest English National Curriculum (2014), but designed with a global outlook, for children aged 11 to 14 – see pages 50-51.

www.pearsonglobalschools.com/exploringscience

38

Edexcel International GCSE (9–1) Science

Developed for the new Pearson Edexcel International GCSE (9–1) specification, these new resources have progression, international relevance and support at their core.

Is it for me?l Specifically developed for international learners,

with appropriate international content, making it engaging and relevant for all learners and allowing for learning in a local context, to a global standard.


l Each Student Book provides 3-years access to an ActiveBook, a digital version of the Student’s Book, which can be accessed online, anytime, anywhere supporting learning beyond the classroom.

l The accompanying Online Teacher Resource Pack (TRP) is an online, annual subscription containing material such as lesson plans, worksheets, and slide decks to support your planning and teaching and save you valuable time.

l Embedded transferable skills, needed for progression to higher education and employment, are signposted so students understand, and can engage with, the skills they’re gaining.

l Reviewed by a language specialist to ensure the book is written in a clear and accessible style, and including a glossaries of specialist subject vocabulary.

l Pearson Progression tools allows quick and easy formative assessment of student progress, linked to guidance on how to personalise learning solutions.

Good to know?3-year access to an online ActiveBook with each Student Book. Online Teacher Resource Packs are available as an annual subscription.


SCIENCE

AGES 14–16


Summary of componentsl Biology Student Book and ActiveBook

l Biology Online Teacher Resource Pack

l Human Biology Student Book and ActiveBook

l Human Biology Online Teacher Resource Pack

l Chemistry Student Book and ActiveBook

l Chemistry Online Teacher Resource Pack

l Physics Student Book and ActiveBook

l Physics Online Teacher Resource Pack

l Science Double Award Student Book and ActiveBook

l Science Double Award Online Teacher Resource Pack

How does it work?

Student Books

Sample page taken from Edexcel International GCSE (9–1) Science Double Award

Sample page taken from Edexcel International GCSE (9–1) Physics

230 UNIT 7 RADIOACTIVITY AND PARTICLES

An isotope of beryllium, 4 13 Be , decays by emitting a neutron. Write a balanced nuclear equation for this transformation.

Write down what you know:

4 13 Be → ? ? ? + 0 1 n

The emission of a neutron has no effect on the charge so the atomic number (Z) is unchanged at 4. Each element has its own atomic number so the element in this decay is unchanged – it is still an isotope of beryllium. The loss of a neutron from the beryllium nucleus means that the atomic mass decreases by one. The completed equation is:

4 13 Be → 4 12 Be + 0 1 n

EXAMPLE 4

GAMMA (γ) DECAY Gamma radiation is high-energy electromagnetic radiation (see page 106). After an unstable nucleus has emitted an alpha or beta particle it sometimes has surplus energy. It emits this energy as gamma radiation. Gamma rays are pure energy, so they do not have any mass or charge. When a nucleus emits a gamma ray there is no change to either the atomic number or the mass number of the nucleus.

LOOKING AHEAD

▲ Figure 22.12 Inside the large Hadron Collider

Understanding the particles that make up all matter in the Universe, how they interact and the forces involved holding matter together remains a major area of research for physicists. This is an introduction to what has been called the ‘particle zoo’. Large particle accelerators, like the Large Hadron Collider (LHC) on the Swiss/French border, have identified many new particles. Energy turned into matter! Research has recognised patterns in these particles and we now have a model that explains many complex nuclear processes – some of which have increased our understanding of how the Universe was formed.

We also understand how matter can be transformed into energy and the amazing amount of energy that results, revealed by Albert Einstein in his famous equation:

E = mc2

Unc

orre

cted

pro

of, a

ll co

nten

t sub

ject

to c

hang

e at

pub

lishe

r dis

cret

ion.

Not

for r

esal

e, c

ircul

atio

n or

dis

tribu

tion

in w

hole

or i

n pa

rt. ©

Pea

rson

201

7

14 PRINCIPLES OF CHEMISTRY ELEMENTS, COMPOUNDS AND MIXTURES

2 ELEMENTS, COMPOUNDS AND MIXTURES

Most of the substances that we are familiar with from everyday life are mixtures, for example the air that we breathe is a mixture containing elements such as nitrogen and oxygen, and compounds such as carbon dioxide and nitrogen oxides. The food that we eat and the things that we drink are mixtures. This chapter looks at the properties of elements, compounds and mixtures, and also how to separate the components of a mixture. Separation of mixtures is very important in the analysis of substances, such as in forensics.

LEARNING OBJECTIVES

◼ Understand how to classify a substance as an element, compound or mixture.

◼ Understand that a pure substance has a fixed melting and boiling point, but that a mixture may melt or boil over a range of temperatures.

◼ Describe these experimental techniques for the separation of mixtures:◼ simple distillation ◼ fractional distillation◼ filtration ◼ crystallisation◼ paper chromatography.

◼ Understand how a chromatogram provides information about the composition of a mixture.

◼ Understand how to use the calculation of Rf values to identify the components of a mixture.

◼ Practical: Investigate paper chromatography using inks/food colourings.

ELEMENTSElements are substances that can’t be split into anything simpler by chemical means. An element contains only one type of atom (but see the Key point in the margin). In models or diagrams they are shown as atoms of a single colour or size.

a pure metalsuch as magnesium

oxygen gas diamond (a form of carbon)

▲ Figure 2.3 Elements contain only one type of atom.

KEY POINT

It isn’t completely true to say that elements consist of only one type of atom. A better way of saying it would be that all the atoms in an element have the same atomic number. Most elements consist of mixtures of isotopes, which have the same atomic number, but different mass numbers (due to different numbers of neutrons). When we draw diagrams or make models, we aren’t usually interested in the differences between the isotopes. Isotopes will be discussed in Chapter 3.

REMINDER

You might want to look at Chapter 3 if you do not already know the term 'atom'.

▲ Figure 2.1 Gold is an element, but a gold ring made from 18 carat gold only contains 75% gold. The metal is a mixture of gold and, usually, copper.

▲ Figure 2.2 Pure water is a compound, but the water we drink is a mixture of water and other dissolved substances.

Unc

orre

cted

pro

of, a

ll co

nten

t sub

ject

to c

hang

e at

pub

lishe

r dis

cret

ion.

Not

for r

esal

e, c

ircul

atio

n or

dis

tribu

tion

in w

hole

or i

n pa

rt. ©

Pea

rson

201

7

Learning objectives Chapters and units are carefully tailored to address key assessment objectives central to the course.

Reminder, key point and hint boxes help summarise the essentials and ensure they are understood.

Examples provide a clear, instructional framework to reinforce understanding.

Looking ahead tells you what you would learn if you continued your study to a higher level, such as International A Level, to support and encourage progression.

40

INORGANIC CHEMISTRY THE ALKALI METALS 127

REACTIONS OF THE ALKALI METALS WITH THE AIRLithium, sodium and potassium are all stored in oil because they react with the air. If we look at a piece of sodium which has been taken out of the oil, it usually has a crust on the outside. It is not shiny unless it has been freshly cut.

When the piece of sodium is cut the fresh surface is shiny but it tarnishes rapidly as the freshly exposed sodium reacts with oxygen in the air. If we do the same with a piece of lithium it tarnishes more slowly because lithium reacts more slowly than sodium. A freshly cut piece of potassium tarnishes extremely rapidly, more quickly than sodium. In this way we can see again that potassium is more reactive than sodium, which is more reactive than lithium. In each case the metal reacts with oxygen in the air to form an oxide with the formula M2O.

If we heat each of the metals in the air using a Bunsen burner, we get a much more vigorous reaction and it is more difficult to see which metal is most reactive because all the reactions are so rapid.

Lithium burns with a red flame to form lithium oxide.

Sodium burns with a yellow flame to form sodium oxide.

Potassium burns with a lilac flame to form potassium oxide.

The equation for all these reactions is:

4M(s) + O2(g) → 2M2O(s)

In each case the product formed is a white powder – the alkali metal oxide.

EXTENSION WORK

When the alkali metals react with air, other types of oxide can also be formed, called peroxides (M2O2) and superoxides (MO2). These all still contain the M+ ion, it is the oxygen bit which is different. Lithium can also form a nitride (Li3N).

COMPOUNDS OF THE ALKALI METALSAll Group 1 metal ions are colourless. That means that their compounds will be colourless or white unless they are combined with a coloured negative ion. Potassium dichromate(VI) is orange, for example, because the dichromate(VI) ion is orange, and potassium manganate(VII) is purple because the manganate(VII) ion is purple. Group 1 compounds are typical ionic solids and are mostly soluble in water.

SUMMARISING THE MAIN FEATURES OF THE GROUP 1 ELEMENTS

Group 1 elements:◾◾ are metals◾◾ are soft with melting points and densities which are very low for metals◾◾ have to be stored out of contact with air or water◾◾ react rapidly with air to form coatings of the metal oxide◾◾ react with water to produce an alkaline solution of the metal hydroxide and hydrogen gas

◾◾ increase in reactivity as you go down the group◾◾ form compounds in which the metal has a 1+ ion◾◾ have mainly white/colourless compounds which dissolve to produce colourless solutions.

REMINDER

Remember the charge on the oxide ion is O2− and the charge on an alkali metal ion is M+.

▲ Figure 11.8 A piece of sodium. The left-hand edge has been freshly cut, so it is shiny.

Unc

orre

cted

pro

of, a

ll co

nten

t sub

ject

to c

hang

e at

pub

lishe

r dis

cret

ion.

Not

for r

esal

e, c

ircul

atio

n or

dis

tribu

tion

in w

hole

or i

n pa

rt. ©

Pea

rson

201

7

PLANT PHYSIOLOGY REPRODUCTION IN PLANTS 179

ACTIVITY 16

▼ PRACTICAL: INVESTIGATING THE CONDITIONS NEEDED FOR GERMINATION

Small seeds such as peas or mustard will grow on wet cotton wool in a test tube. Figure 13.A shows four tubes set up to investigate the conditions needed for the seeds to germinate.

wet cottonwool

A B

kept at 20°C kept at 4°C

C D

seeds

wet cottonwool

dry cottonwool

seeds

boiledwater

oil

▲Figure 13.8 Apparatus to investigate the conditions needed for germination.

The water in tube C has been boiled to remove dissolved oxygen. The layer of oil (e.g. cooking oil) keeps out oxygen from the air.

◾ Tube A: seeds on wet cotton wool, maintained at 20 °C (room temperature)

◾ Tube B: seeds on dry cotton wool, maintained at 20 °C◾ Tube C: seeds in boiled water, with a thin surface layer of oil; maintained at 20 °C

◾ Tube D: seeds on wet cotton wool, placed in a refrigerator at 4 °CAfter a few days the seeds in the control tube (A) will start to germinate. There will be no germination in tubes B or C. The seeds in tube D may eventually start to germinate, but much more slowly than in tube A.What do the results tell you about the conditions needed for germination? Do you have any criticisms of this method? (Hint – are all the variables fully controlled?)

CHAPTER QUESTIONSMore questions on reproduction in plants can be found at the end of Unit 3 on page 182.

1 Which of the following features are shown by wind-pollinated flowers?A Large petals, a scent and sticky pollen grainsB Small petals, no scent and light pollen grainsC Large petals, no scent and light pollen grainsD Small petals, a scent and sticky pollen grains

2 During pollination, between which of the following structures are pollen grains transferred?A From anther to stigma B From anther to ovaryC From stigma to style D From stigma to ovary

SKILLS CRITICAL THINKING 4

4

Unc

orre

cted

pro

of, a

ll co

nten

t sub

ject

to c

hang

e at

pub

lishe

r dis

cret

ion.

Not

for r

esal

e, c

ircul

atio

n or

dis

tribu

tion

in w

hole

or i

n pa

rt. ©

Pea

rson

201

7Student Books

Sample page taken from Edexcel International GCSE (9–1) Chemistry

Sample page taken from Edexcel International GCSE (9–1) Science Double Award

Extension work highlights content that goes beyond and above what is in the specification and will help extend students’ understanding of the topic.

A wide range of varied activities toencourage and embed understanding.

Chapter Questions throughout test your knowledge of the topic in that chapter and unit questions test your knowledge of the whole unit and provide quick, effective feedback on progress.

Transferable Skills needed for progression into higher education and employment are embedded throughout and explicitly signposted, allowing students to understand, and engage with, the skills they’re gaining.

Progression icons show the level of difficulty according to the Pearson Progression Scale and help students progress and reach their full potential.

SCIENCE

AGES 14–16


Online Teacher Resource Packs


If you like this, you may also like...Resources for the Edexcel International A Level (IAL) in Science (see page 44-47). Edexcel International GCSE (9–1) is available for a range of subjects (see page 10).

The Edexcel International GCSE (9–1) Online Teacher Resource Packs are annual subscriptions containing material to support your planning and teaching and save you valuable time. They include:

l lesson plans

l worksheets

l multiple choice quizzes

l mock exam paper and mark scheme

l model exam answers.

EDEXCEL INTERNATIONAL GCSE (9–1) SCIENCETo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

BIOLOGYBiology Student Book and Activebook 978 0 435185 08 4Online Teacher Resource Pack Biology 978 0 435185 05 3Human Biology Student Book and Activebook

978 0 435184 98 8

Online Teacher Resource Pack Human Biology

978 0 435191 37 5

CHEMISTRYChemistry Student Book and ActiveBook 978 0 435185 16 9Online Teacher Resource Pack Chemistry 978 0 435185 12 1

PHYSICSPhysics Student Book and ActiveBook 978 0 435185 27 5Online Teacher Resource Pack Physics 978 0 435185 24 4

SCIENCEDOUBLEAWARDScience Double Award Student Book and Activebook

978 0 435185 28 2

Science Double Award Online Teacher Resource Pack

978 0 435185 31 2

REVISIONSUPPORTOur revise titles support all International GCSE and GCSE courses www.pearsonglobalschools.com/reviseGCSERevise GCSE Study Skills Guide 978 1 447967 07 1Revise GCSE Revision Planner 978 1 447967 82 8Revise GCSE Spelling, Punctuation and Grammar Revision Guide

978 1 292211 52 7

Revise GCSE Spelling, Punctuation and Grammar Revision Workbook

978 1 292211 49 7

42

Edexcel GCSE (9–1) Sciences

Is it for me?l The resources, the teaching approach and the

digital service are simple and intuitive to use.

l Includes a Support version of the course for lower attainers.

l Inspiring resources that truly engage and motivate.

l Unique Checkpoint teaching and learning supports students to develop the skills required for the new assessments.

l Extensive exam practice and preparation.

l Support to deliver core practicals.

l Tracks progression from 11-16.

What’s special?l Edexcel GCSE (9–1) Combined Science, Support

Edition with ELC, Student Book. This Student Book follows a specifically designed route through the qualification to help you focus on the key concepts of the Edexcel GCSE Combined Science qualification. It also supports the Entry Learning Certificate course.

Our resources for the Pearson Edexcel GCSE (9–1) Combined Science, Biology, Chemistry and Physics qualifications are designed to be straightforward, inclusive and inspiring – helping you to deliver great science teaching, creating confident learners able to meet the higher expectations of the 9–1.

Summary of componentsl 4 Student Books – one for each of the three

subjects (Biology, Chemistry and Physics) and one for Combined Science.

l 4 ActiveBook institutional licences (one for each of the three subjects – Biology, Chemistry and Physics – and one for Combined Science) hosted on ActiveLearn Digital Service and available in 5 subscription one-year licence options.

l 2 ActiveLearn Digital Service licence options – Combined Science or Biology, Chemistry, Physics and Combined Science – available in five, one-year licence options and including access to a wide range of features.

l 4 Revision Guides (one for each of the three subjects – Biology, Chemistry and Physics – and one for Combined Science).

l 4 Revision Workbooks (one for each of the three subjects – Biology, Chemistry and Physics – and one for Combined Science).


Contains audio


SCIENCE

AGES 14–16

43www.pearsonglobalschools.com/edexcelgcsescience

HOW TO SAMPLEEvaluate with a free 60-day trial of ActiveLearn Digital Service (includes access to the ActiveBook, planning, activity and assessment materials and the Homework and Practice Service), go to www.pearsonglobalschools.com/ALDStrial, select the programmes you would like to sample and complete your details on the form. Please allow 7 UK working days for the trial to be set-up.

EDEXCEL GCSE (9–1) SCIENCE To place an order for ActiveLearn Digital Service and ActiveBooksStep 1: Identify which tier your school size matches. Small school is fewer than 100 pupils Medium school is 101-300 pupils Large school is 301-500 pupils Extra Large school is 501-999 pupils Super school is 1000+ pupilsStep 2: Select the ISBNs you want access to. These can be found under the component section of each product page.Step 3: Complete the International digital subscription order form at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

STUDENTBOOKSBiology Student Book 978 1 292120 20 1Chemistry Student Book 978 1 292120 21 8Physics Student Book 978 1 292120 22 5Combined Science Student Book 978 1 292120 19 5Edexcel GCSE (9–1) Combined Science, Support edition with ELC, Student Book

978 1 292194 06 6

EDEXCELGCSECOMBINEDSCIENCELABBOOKSCombined Science Lab Book 1 978 1 292175 68 3Combined Science Lab Book 2 978 1 292175 69 0

ACTIVEBOOKS(DIGITALVERSIONSOFTHESTUDENTBOOK)BIOLOGYBiology ActiveBook Subscription, INTERNATIONAL SMALL

978 1 292176 50 5

Biology ActiveBook Subscription, INTERNATIONAL MEDIUM

978 1 292176 49 9

Biology ActiveBook Subscription, INTERNATIONAL LARGE

978 1 292176 48 2

Biology ActiveBook Subscription, INTERNATIONAL EXTRA LARGE

978 1 292176 52 9

Biology ActiveBook Subscription, INTERNATIONAL SUPER

978 1 292176 51 2

CHEMISTRYChemistry ActiveBook Subscription, INTERNATIONAL SMALL

978 1 292176 55 0

Chemistry ActiveBook Subscription, INTERNATIONAL MEDIUM

978 1 292176 54 3

Chemistry ActiveBook Subscription, INTERNATIONAL LARGE

978 1 292176 53 6

Chemistry ActiveBook Subscription, INTERNATIONAL EXTRA LARGE

978 1 292176 57 4

Chemistry ActiveBook Subscription, INTERNATIONAL SUPER

978 1 292176 56 7

PHYSICSChemistry ActiveBook Subscription, INTERNATIONAL SMALL

978 1 292176 65 9


978 1 292176 64 2


978 1 292176 63 5


978 1 292176 67 3


978 1 292176 66 6

COMBINED SCIENCEChemistry ActiveBook Subscription, INTERNATIONAL SMALL

978 1 292176 60 4


978 1 292176 59 8


978 1 292176 58 1


978 1 292176 62 8


978 1 292176 61 1

ACTIVELEARNDIGITALSERVICEContains licenses for ActiveTeach, the Activity & Assessment Pack, the Teacher and Technician Planning Pack and the Homework, Practice and SupportCOMBINED SCIENCECombined Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL SMALL

978 1 292187 06 8

Combined Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL MEDIUM

978 1 292187 07 5

Combined Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL LARGE

978 1 292187 08 2

Combined Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL EXTRA LARGE

978 1 292187 09 9

Combined Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL SUPER

978 1 292187 10 5

FULLSCIENCE(BIOLOGY,CHEMISTRY,PHYSICSANDCOMBINEDSCIENCE)Full Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL SMALL

978 1 292187 12 9

Full Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL MEDIUM

978 1 292187 13 6

Full Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL LARGE

978 1 292187 14 3

Full Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL EXTRA LARGE

978 1 292187 11 2

Full Science ActiveLearn Digital Service Subscription Pack - INTERNATIONAL SUPER

978 1 292187 15 0


If you like this you may also like...Exploring Science: Working Scientifically provides you and your students with seamless progression to GCSE. Find out more on pages 34–37.

44

Edexcel International A Level (IAL) Science


Is it for me?l Recognised by universities worldwide and fully

comparable to UK reformed GCE A levels.



l The course is fully matched to the specification, with specification references highlighted in every chapter.


l Accompanying Online Teacher Resource Packs (TRP) contain material such as lesson plans, assessments and mark schemes, and further resources for practicals to support your planning and teaching and save you valuable time.

What’s special?l These are brand new resources to support

the updated Edexcel International Advanced Level (IAL) in Science, for first teaching from September 2018.

NEW

Good to know?Each Student Book comes with 3-years access to an online ActiveBook. The online Teacher Resource Packs are available as an annual subscription.


SCIENCE

AGES 16–18

45www.pearsonglobalschools.com/IAL

How does it work?

Planning Matched to the new 2018 specificationsThese new resources are written specifically to offer a complete match to the content, structure and modular approach of the new 2018 specifications. Offering support to a qualification that is fully comparable to the reformed UK GCE A levels, and recognised as equal to the GCE by universities worldwide.

Better support for youThe online teacher resources provide a range of planning, teaching and assessment resources, saving you valuable time.

Teaching and learningInternationally appropriate contentAppropriate international content puts learning in a real-world context, to a global standard, and includes a range of relevant contexts, photos, and examples – making it engaging and relevant for all learners. Language is reviewed by a specialist to ensure materials are written in a clear and accessible style.

PLANT STRUCTURE AND FUNCTION4 4B CLASSIFICATION

TOPIC 4 PLANT STRUCTURE AND FUNCTION, BIODIVERSITY AND CONSERVATION

4B CLASSIFICATIONCH

APT

ER

In 2012, scientists working in Papua New Guinea found the smallest known vertebrate to date – a tiny frog measuring 7.7 mm in length. Paedophryne amanuensis feeds on tiny mites in the leaf litter of its rain forest home – and it can jump up to 30 times its own body length. DNA analysis shows that tiny frogs have evolved 11 times in different areas of the world, all filling a similar niche. In 2014, a new species of dead-leaf toad (Rhinella yunga) was discovered in the Peruvian Andes. In shape, colour and patterning, it resembles a dead leaf and, with the poison it exudes from glands on the back of its head, the toad looks similar to other toads of the same genus. It was only when scientists noticed that these toads lack ear drums that they realised they had discovered a new species. Finding new species is always exciting, but it becomes even more special when that new species is already endangered, such as the new species of orang utan identified in November 2017.

Scientists used two different methods of identifying these new species – traditional observation of physical characteristics such as ear drums, and DNA analysis of the genome. In this chapter you will find out more about how we classify the organisms in the world around us – and why it is important that we do so.

You will learn the main taxonomic groups of the living world including domains, kingdoms and species, and will begin to classify different organisms. You will consider the problems of defining a species in a way that is useful for all types of organisms, and evaluate the different ones in use. The use of DNA technology is having a major impact on our ability to identify organisms and work out how they are related to other species. There has been a long-running debate about the numbers of domains and kingdoms which should be used in classification – decide who you think is right!

MATHS SKILLS FOR THIS TOPIC • Recognise and use expressions in decimal and standard form (e.g. when considering the number of base pairs in

DNA and the proportion of those base pairs that may differ between species)

• Use scales for measuring (e.g. size and parts of different organisms for comparisons when classifying)

• Use ratios, fractions and percentages (e.g. regarding the proportion of base pairs shared in genes from different species)

Sample page from Edexcel International AS/A Level Biology Student Book 1

An introduction to the chapter helps students think about the concepts they will be introduced to.

A Maths skills section at the end of the book provides reference and practice of skills needed.

Science Lab BooksThe Science Student Books are supported by Lab Books, which cover requirements for the twoPractical Skills Papers. The Lab Books include Core Practical procedures, skills practice and worksheets. Student records of experiments and extra writing support can be used as areference for revision for the practical papers.

46

What prior knowledge do I need? • Classifi cation

• The importance of biodiversity

• The impact of developments in biology on classifi cation systems

Chapters 2C and 3B • Gene mutations and genetic variation caused by

meiosis and sexual reproduction

Chapter 3C • That there is extensive genetic variation within

a species

What will I study in this chapter? • The reasons for classifi cation

• The hierarchy of classifi cation: domain, kingdom, phylum, class, order, family, genus and species

• The common defi nition of a species as a group of organisms with similar characteristics that normally interbreed to produce fertile offspring – and the many limitations of this defi nition

• Other ways in which a species can be defi ned

• Why there are problems in assigning organisms to a species, identifying new species, and how these problems are being addressed

• The increasing value of DNA sequencing in distinguishing between species and in helping to determine the relationships between species

• The evidence for the three-domain model of classifi cation as an alternative to the fi ve-kingdom model

What will I study later?Topic 4C

• Biodiversity

• How to measure biodiversity

• How species are well adapted to their habitat

• That variation within a species is important

• How new species arise as a result of natural selection

• How reproductive isolation can cause the formation of new species

• The concept of a gene pool and how the proportion of alleles can change within a population

• The need to conserve endangered species

Topic 5B (Book 2: IAL) • The need to be able to classify organisms for

practical investigations of populations in the fi eld

• Understand the concepts of niche and succession

M04B_IASL_BIOL_44846_TP4B_246-263.indd 247 30/05/2018 14:39Sample page from Edexcel International AS/A Level Biology Student Book 1

Assessment Lots of exam practiceExam practice provides opportunities to assess understanding and progress, so students can make the best progress they can.

Signposted transferable skillsTransferable skills, needed for progression into higher education and employment, are embedded throughout the Student Books, and explicitly signposted, so students understand what skills they are developing and therefore go on to use these skills more effectively in the future.

Home learningSupporting learning beyond the classroomEach Student Book provides access to an ActiveBook, which is a digital version of the Student Book, and can be accessed online, anytime, anywhere.

Assumed knowledge and key concepts are outlined. Cross references throughout the book reference prior and future learning in the course.

Additional features of the science books:l Checkpoint questions at

the end of each section help students check their understanding. Questions are designed to stimulate discussion and use of prior knowledge. These can be tackled as individuals, pairs, groups or the whole class.

l Thinking Bigger spreads explore applications of science learnt in real life and science communications

l Practical skills boxes provide a summary of practical experiments that explore key concepts.

SCIENCE

AGES 16–18

47www.pearsonglobalschools.com/IAL

International Schools CommunityJoin the important conversations happening now.

Stay in touch on Facebook. Search @PearsonInternationalSchools

community.pearsoninternationalschools.com RC2285_RH_FINAL.indd 1 06/11/2018 13:45


If you like this you may also like...Edexcel International GCSE (9–1) in Science - see pages 38–41

CHEMISTRYEdexcel International AS Level Chemistry Student Book and ActiveBook 1

978 1 292244 86 0

Edexcel International A Level Chemistry Student Book and ActiveBook 2*

978 1 292244 72 3

Edexcel International AS & A Level Chemistry Lab book

978 1 292244 71 6

Edexcel International AS Level Chemistry Teacher Resource Pack (ALDS) 1

978 1 292244 89 1

Edexcel International A Level Chemistry Teacher Resource Pack (ALDS) 2^

978 1 292244 74 7

PHYSICSEdexcel International AS Level Physics Student Book and ActiveBook 1

978 1 292244 87 7

Edexcel International A Level Physics Student Book and ActiveBook 2*

978 1 292244 77 8

Edexcel International AS & A Level Physics Lab book

978 1 292244 75 4

Edexcel International AS Level Physics Teacher Resource Pack (ALDS) 1

978 1 292244 91 4

Edexcel International A Level Physics Teacher Resource Pack (ALDS) 2^

978 1 292244 80 8

EDEXCEL INTERNATIONAL A LEVEL (IAL) IN SCIENCETo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact. Orders for the Online Teacher Resource Packs need to be accompanied by a digital subscription order form which can be downloaded at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

BIOLOGYEdexcel International AS Level Biology Student Book and ActiveBook 1

978 1 292244 84 6

Edexcel International A Level Biology Student Book and ActiveBook 2*

978 1 292244 70 9

Edexcel International AS & A Level Biology Lab book

978 1 292244 69 3

Edexcel International AS Level Biology Teacher Resource Pack (ALDS) 1

978 1 292244 88 4

Edexcel International A Level Biology Teacher Resource Pack (ALDS) 2^

978 1 292244 73 0

*Available April 2019^Available May 2019

http://www.pearsonglobalschools.com/IAL

48

Edexcel A level Sciences

Is it for me?l Helps students develop a deep subject

understanding

l Developed with experts to create approaches that embed learning of scientific concepts and skills

l Helps overcome barriers to learning to develop confident and independent scientists

l Supports development of the essential maths required for A level science

l Enables students to master core concepts through the online Homework and Practice service

What’s special?l Comprehensive coverage of the topics in the

new specifications

l ActiveLearn Digital Service, providing online, subscription-based teaching and learning for class and home

l Revision Guides and Workbooks to provide plenty of practise for the new exams

Resources written specifically to help you teach the Pearson Edexcel AS and A level Science specifications for 2015, and to develop successful independent scientists able to progress from GCSE to AS/A level and beyond.


Contains audio

SCIENCE

AGES 16–18

49

EDEXCEL AS AND A LEVEL SCIENCE 2015To place an order for ActiveBooks and ActiveLearn Digital Service (Homework and Practice)Step 1: Identify the number of user lecences you require and select the ISBN you want to access.Step 2: Complete the International digital subscription order form at www.pearsonglobalschools.com/orderform.Send this with your order via your usual ordering method.

STUDENTBOOKSAll Student Books include a free online ActiveBook. Individual ActiveBooks are also available, please visit the website for details.Edexcel AS/A level Biology B Student Book 1 978 1 447991 14 4Edexcel AS/A level Chemistry Student Book 1

978 1 447991 16 8

Edexcel AS/A level Physics Student Book 1 978 1 447991 18 2Edexcel A level Biology B Student Book 2 978 1 447991 15 1Edexcel A level Chemistry Student Book 2 978 1 447991 17 5Edexcel A level Physics Student Book 2 978 1 447991 19 9

ACTIVEBOOKS (POWEREDBYACTIVELEARNDIGITALSERVICE)Individual student, single-user licence (The price is per student for three years access)EDEXCELAS/ALEVELBIOLOGYBACTIVEBOOK(INDIVIDUAL)ActiveBook 1 - SINGLE-USER LICENCE 978 1 447977 34 6ActiveBook 2 - SINGLE-USER LICENCE 978 1 447977 35 3EDEXCELAS/ALEVELCHEMISTRYACTIVEBOOK(INDIVIDUAL)ActiveBook 1 - SINGLE-USER LICENCE 978 1 447977 36 0ActiveBook 2 - SINGLE-USER LICENCE 978 1 447977 37 7EDEXCELAS/ALEVELPHYSICSACTIVEBOOK(INDIVIDUAL)ActiveBook 1 - SINGLE-USER LICENCE 978 1 447977 38 4ActiveBook 2 - SINGLE-USER LICENCE 978 1 447977 57 5

Institutional, multiple-user licence (The price is for one year’s access for the number of students shown)EDEXCELAS/ALEVELBIOLOGY2015ACTIVEBOOK(INSTITUTION)Up to 10-USERS LICENCE 978 1 292103 36 5Up to 15-USERS LICENCE 978 1 292111 27 8Up to 20-USERS LICENCE 978 1 292112 28 5Up to 50-USERS LICENCE 978 1 292111 30 8Up to 75-USERS LICENCE 978 1 292111 31 5Up to 150-USERS LICENCE 978 1 292111 32 2EDEXCELAS/ALEVELCHEMISTRY2015ACTIVEBOOK(INSTITUTION)Up to 10-USERS LICENCE 978 1 292103 53 2Up to 15-USERS LICENCE 978 1 292103 37 2Up to 20-USERS LICENCE 978 1 292113 38 9Up to 50-USERS LICENCE 978 1 292103 39 6Up to 75-USERS LICENCE 978 1 292103 40 2Up to 150-USERS LICENCE 978 1 292103 41 9EDEXCELAS/ALEVELPHYSICS2015ACTIVEBOOK(INSTITUTION)Up to 10-USERS LICENCE 978 1 292103 73 0 Up to 15-USERS LICENCE 978 1 292103 54 9Up to 20-USERS LICENCE 978 1 292113 55 6Up to 50-USERS LICENCE 978 1 292103 56 3Up to 75-USERS LICENCE 978 1 292103 57 0Up to 150-USERS LICENCE 978 1 292103 58 7

TEACHERRESOURCEPACK (POWEREDBYACTIVELEARNDIGITALSERVICE)Price is per pack. Packs are one-off downloads.Edexcel AS/A level Biology B Teacher Resource Pack 1

978 1 447977 42 1

Edexcel AS/A level Chemistry Teacher Resource Pack 1

978 1 447977 43 8

Edexcel AS/A level Physics Teacher Resource Pack 1

978 1 447977 58 2

Edexcel A level Biology B Teacher Resource Pack 2

978 1 447977 41 4

Edexcel A level Chemistry Teacher Resource Pack 2

978 1 447977 69 5

Edexcel A level Physics Teacher Resource Pack 2

978 1 447977 59 9

HOMEWORKANDPRACTICESERVICE (POWEREDBYACTIVELEARNDIGITALSERVICE)Individual student, single-user licence (The price is per student for two years access)Edexcel AS/A level Biology B - SINGLE-USER LICENCE

978 1 292112 96 1

Edexcel AS/A level Chemistry - SINGLE-USER LICENCE

978 1 292113 04 3

Edexcel AS/A level Physics - SINGLE-USER LICENCE

978 1 292113 12 8

Institutional, multiple-user licence (The price is for one years access for the number of students shown)EDEXCELAS/ALEVELBIOLOGY2015HOMEWORK,PRACTICEANDSUPPORTUp to 5-USERS LICENCE 978 1 292112 93 0Up to 10-USERS LICENCE 978 1 292113 13 5Up to 15-USERS LICENCE 978 1 292112 90 9Up to 20-USERS LICENCE 978 1 292112 92 3Up to 50-USERS LICENCE 978 1 292112 94 7Up to 75-USERS LICENCE 978 1 292112 95 4Up to 150-USERS LICENCE 978 1 292112 9 16EDEXCELAS/ALEVELCHEMISTRY2015HOMEWORK,PRACTICEANDSUPPORTUp to 5-USERS LICENCE 978 1 292113 01 2Up to 10-USERS LICENCE 978 1 292112 97 8 Up to 15-USERS LICENCE 978 1 292112 98 5 Up to 20-USERS LICENCE 978 1 292113 00 5 Up to 50-USERS LICENCE 978 1 292113 02 9Up to 75-USERS LICENCE 978 1 292113 03 6 Up to 150-USERS LICENCE 978 1 292112 99 2 EDEXCELAS/ALEVELPHYSICS2015HOMEWORK,PRACTICEANDSUPPORTUp to 5-USERS LICENCE 978 1 292113 09 8Up to 10-USERS LICENCE 978 1 292113 05 0 Up to 15-USERS LICENCE 978 1 292113 06 7 Up to 20-USERS LICENCE 978 1 292113 08 1Up to 50-USERS LICENCE 978 1 292113 10 4Up to 75-USERS LICENCE 978 1 292113 11 1Up to 150-USERS LICENCE 978 1 292113 07 4

REVISIONGUIDESANDWORKBOOKSEdexcel AS/A level Biology B Revision Guide 978 1447989 96 7

Edexcel AS/A level Chemistry Revision Guide 978 1447989 97 4

Edexcel AS/A level Physics Revision Guide 978 1447989 98 1

Edexcel AS/A level Biology B Revision Workbook

978 1447989 93 6

Edexcel AS/A level Chemistry Revision Workbook

978 1447989 94 3

Edexcel AS/A level Physics Revision Workbook

978 1447989 95 0

www.pearsonglobalschools.com/edexcelalevelscience2015

50

iLowerSecondary

iLowerSecondary is a complete programme based on the latest English National Curriculum (2014), but designed with a global outlook, for children aged 11 to 14. Together with iPrimary, it provides a complete programme from ages 5-14 and is excellent preparation for progression to International GCSE (IG) and International Advanced Level (IAL). It’s a complete teaching toolkit to support you all the way from planning, to teaching and learning, through to assessment.

An international curriculum. Draw your students in with an

internationally-focused curriculum and ensure knowledge sticks with accessible and culturally-relevant

examples and resources.

Full Schemes of Work and Lesson Plans. Cut your

planning time and guide your students through the

curriculum with our ready-made Schemes of Work.

Comprehensive teacher support. Easily work out

exactly what to teach and when with our detailed

Teacher’s Guides.

Professional Development. Keep your skills sharp with free

face-to-face teacher training and online PD support.

Foundation for future success. Steer students towards success

at International GCSE with a curriculum that builds on their

learning at every stage.

Internal and external assessment. Measure your students’ learning

with built-in Progress and Achievement Tests.

Teach the iPrimary and iLowerSecondary curriculum with ease and confidence, using

resources that you know and trust from Pearson.

LOW

ER SECON

DA

RY CURRICU

LUM

AGES 11-14


Mapped resources for iLowerSecondaryOur experts have fully mapped our world-renowned published resources to iLowerSecondary learning objectives from years 7–9, so that you can start teaching straight away, with the peace of mind that you have all you need.

Text: Building Skills in English for iLowerSecondary English By focusing on building up key language skills and finding ways to engage and motivate students, Text: Building skills in English has been designed to capture the imagination of all Key Stage 3 students at every opportunity. Text offers you a wide range of relevant and engaging materials to help you deliver compelling lessons.

See www.pearsonglobalschools.com/text for more details.

KS3 Maths Progress for iLowerSecondary MathematicsOur KS3 Maths Progress course has been carefully developed by the same series editors as our Pearson Edexcel GCSE (9–1) Mathematics course. It has the same mastery approach and unique unit structure with in-built differentiation, to help build confidence in maths and to provide you with a consistent teaching and learning experience from ages 11 to 16.

See pages 16-19 for more details.

Exploring Science: Working Scientifically for iLowerSecondary ScienceOur best-selling Exploring Science: Working Scientifically is the comprehensive digital and print service for all your planning, teaching, learning, homework and assessment needs for the UK science curriculum.

See pages 34-37 for more details.

Learn more at qualifications.pearson.com/ilowersecondary

52

Skills for Writing

Skills for Writing is a unique digital and print solution designed to accelerate progress in writing by embedding the principles of the proven Grammar for Writing pedagogy. Developed in partnership with Professor Debra Myhill and her team from the University of Exeter, UK, Skills for Writing has been trialled and is proven to accelerate the rate of writing significantly – offering you a clear route to Key Stage 4 success.

Is it for me?l Teaches grammar in a contextualised way, always focusing on effects

achieved, so students have a wider range of techniques with which to craft creative, effective texts.

l Provides engaging and interactive lessons with on-screen Student Books and many digital resources focused on building grammatical knowledge and improving writing.

l Motivates students to write independently, encouraging them to reflect on their writing and understand how to improve, with our range of auto-marked activities.

What’s special?l New ActiveLearn Digital Service format, providing online, subscription-

based teaching and learning for class and at home.


Contains audio


Sample screen from Skills for Writing ActiveLearn Spy Fiction

If you like this you may also like...iLowerSecondary our new complete programme based on the latest English National Curriculum (2014), but designed with a global outlook, for children aged 11 to 14 – see pages 50-51.

ENG

LISH LA

NG

UA

GE

AGES 11–14

53www.pearsonglobalschools.com/skillsforwriting

HOW TO SAMPLEEvaluate with a free 60-day trial of ActiveLearn Digital Service (includes access to the Teacher Guide, ActiveBook and the Homework Practice and Support Service), go to www.pearsonglobalschools.com/ALDStrial, select the programmes you would like to sample and complete your details on the form. Please allow 7 UK working days for the trial to be set-up.

SKILLS FOR WRITINGTo place an order for ActiveLearn Digital Service and ActiveBooksStep 1: Identify which tier your school size matches. Small school is fewer than 100 pupils Medium school is 101-300 pupils Large school is 301-500 pupils Extra Large school is 501-999 pupils Super school is 1000+ pupilsStep 2: Select the ISBNs you want access to. These can be found under the component section of each product page.Step 3: Complete the International digital subscription order form at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

ACTIVELEARNDIGITALSERVICEActiveLearn Digital Service Subscription, INTERNATIONAL SMALL

978 1 292137 27 8

ActiveLearn Digital Service Subscription, INTERNATIONAL MEDIUM

978 1 292137 26 1

ActiveLearn Digital Service Subscription, INTERNATIONAL LARGE

978 1 292137 25 4

ActiveLearn Digital Service Subscription, INTERNATIONAL EXTRA LARGE

978 1 292137 24 7

ActiveLearn Digital Service Subscription, INTERNATIONAL SUPER

978 1 292137 28 5

STUDENTRESOURCESStudent Book Pack Units 1-6 978 1 447948 81 0ActiveBook Subscription, INTERNATIONAL SMALL

978 1 292137 22 3

ActiveBook Subscription, INTERNATIONAL MEDIUM

978 1 292137 21 6

ActiveBook Subscription, INTERNATIONAL LARGE

978 1 292137 20 9

ActiveBook Subscription, INTERNATIONAL EXTRA LARGE

978 1 292137 19 3

ActiveBook Subscription, INTERNATIONAL SUPER

978 1 292137 23 0


* Not for sale in US

Silvio Berlusconi once again m

anaged to monopolise the Italian

general

election cam

paign

in

Two househ

olds, both al

ike in dig

nity, i

n fair Verona, where we lay our scene, from ancie

nt grudge break to ne

w mutiny, wher

e civil blood makes

I am what you have made me. Take all the pra

ise, take all t

he blame; tak

e all t

he success, t

ake all the fa

ilure;

That’s the thing about people who mean everything they say.

Whatever we call

beauti

ful, we q

uiver before it. And what co

uld b

e more terrifying and

Take another glass of wine, and excuse my

mentioning that society as a body does not expect one to be so s

trictly c

onscientious in emptying one's gla

ss,

Those w

ho find ugly meanings in beautiful things are corrupt

Silvio Berlusconi once again m

anaged to monopolise the Italian

general

election cam

paign

in

Two househ

olds, both al

ike in dig

nity, i

n fair Verona, where we lay our scene, from ancie

nt grudge break to ne

w mutiny, wher

e civil blood makes

I am what you have made me. Take all the pra

ise, take all t

he blame; tak

e all t

he success, t

ake all the fa

ilure;

That’s the thing about people who mean everything they say.

Whatever we call

beauti

ful, we q

uiver before it. And what co

uld b

e more terrifying and

Take another glass of wine, and excuse my

mentioning that society as a body does not expect one to be so s

trictly c

onscientious in emptying one's gla

ss,

Those w

ho find ugly meanings in beautiful things are corrupt

6 7

Unit 1: Spy fiction

The opening of a story must grab the reader’s interest. If the reader loses interest and stops reading at the end of the first page, it does not matter how good the second page is!

Activity 1Read the extract below, taken from the very first page of The Bourne Imperative. This is the tenth novel in the series about Robert Ludlum’s spy hero, Jason Bourne.

1 What do you learn about the two characters in the extract? Make a note of everything you learn about the man and the woman who is chasing him.

2 What do you not learn about the man and the woman in the extract? Make a note of all the questions you would like answered in the next two or three pages of the novel.

3 What impact do you think the writer wants this opening to have on the reader? Is it successful? Why?

PrologueShe came out of the mist, and he was running, just as he had been for hours, days. It felt like he had been alone for weeks, his heart continually thundering inside his chest, his mind befogged with bitter betrayal. Sleep was unthinkable, rest a thing of the past.

Nothing was clear now except that she had come out of the mist after he had been certain – for the thirteenth, or was it the fifteenth, time? – that he had eluded her. But here she was, coming for him like a mythical exterminating angel, indestructible and implacable.

His life had been reduced to the two of them. Nothing else existed outside the wall of white – snow and ice and the wispy brushstrokes of fishing cottages, deep red with white trim, small, compact.

The mist burned like fire – a cold fire that ran up his spine and gripped the back of his neck.

Half-skating across a large frozen lake, he slipped, lost his gun, which went skittering over the ice. He was about to make a lunge for it when he heard the snap of a twig, as clear and sharp as a knife thrust.

Instead, he continued on, made for a stand of shivering pines. Powdery snow sprayed his face, coating his eyebrows and the stubble of a long flight across continents. He did not dare waste another moment looking back over his shoulder to check the progress of his pursuer.

2 Grabbing your reader

WRITER’S WORKSHOP: Grabbingthereader’sinterestLearning objectives

•Understandthatwritersusetheopeningoftheirstorytograbthereader’sinterest

•Understandhowwriterscanusepronounsandnounphrasestoachievethis

Writers make choices about how much information to reveal to the reader, and the ways in which they will reveal it. Think about some of the questions below when you write the opening to your spy story.

Activity 21 Write the opening three or four sentences of a spy story in which one character is being

chased by another. You could use a setting like either of those shown in the pictures below or you could choose your own.

Before you start writing:

• decide what effect you want your opening to have on the reader

• decide how much information you will reveal about the characters, the setting and the action

• note down some noun phrases you could use to help the reader picture the setting of your story.

What do I want my reader to know about the characters who appear in the opening of my story?Pronouns (I, you, he, she, we, they) reveal little except the number of characters or the gender of the characters. Writers can use them to withhold information from the reader, making them ask questions like ‘Who is this person?’ This can engage the reader’s interest by making them want to discover the answers.

Read the opening of The Bourne Imperative again. How would the impact of this opening be altered if the writer had used the characters’ names – Jason Bourne and Rebeka – instead of the pronouns ‘he’ and ‘she’?

What do I want my reader to know about the setting for the opening of my story?The setting may not be the most interesting or attention-grabbing feature of a story opening. Writers might give the bare minimum of information to ‘paint a picture’ of the setting, leaving the reader to concentrate on the characters or the action.

Look at the noun phrases that the writer has used to describe the setting in the opening of The Bourne Imperative:

Is this enough, too little or too much information for the reader to picture the setting?

a large frozen lake

a stand of shivering pines

the mist the wall of white snow

ice

the wispy brushstrokes of fishing cottages

What do better writers do?

Better writers know the effect they want their opening to have on the reader. They achieve this effect by deciding how much information to reveal about the characters, the setting and the action.

Extracts from real texts are used to encourage students to explore the choices made by writers.

The Writer’s Workshop focuses on key grammar features covered in each lesson, giving definitions of grammatical terminology and modelling how grammar choices can be made to create different effects.

Activities give students a chance to put their learning into practice. These help to develop the core writing and linguistic analysis skills required at KS3 and into GCSE.

54

Edexcel International GCSE (9–1) English


Is it for me?l Written by a team of highly experienced English

teachers, authors and academics.

l Specifically developed for international learners, with appropriate international content, making it engaging and relevant for all learners and allowing for learning in a local context, to a global standard.


l Each Student Book provides access to an ActiveBook, a digital version of the Student’s Book, which can be accessed online, anytime, anywhere supporting learning beyond the classroom.



l Pearson Progression tools allows quick and easy formative assessment of student progress, linked to guidance on how to personalise learning solutions.



ENG

LISHAG

ES 14–16

55

Summary of componentsl English Language A Student Book and ActiveBook

l English Language A Online Teacher Resource Pack

l English Language B Student Book and ActiveBook

l English Language B Online Teacher Resource Pack

l English Literature Student Book and ActiveBook

l English Literature Online Teacher Resource Pack

l English as a Second Language Student Book and ActiveBook

l English as a Second Language Teacher’s Book

l English as a Second Language Online Teacher Audio Pack

English as a Second Language Student and Teacher Books

www.pearsonglobalschools.com/internationalgcse

Sample page taken from Edexcel International GCSE (9–1) ESL

70 UNIT 3: LISTENING PREPARATION LISTENING PART 1

LISTENING PART 1

THE WORLD OF WORK

LEARNING OBJECTIVES

◼ Talk about jobs and work experience

◼ Prepare for Part 1 of the Listening exam

◼ Understand the overall message of a spoken text

◼ Identify details in a spoken text

◼ Build new vocabulary (nouns: the world of work)

◼ Use wh- questions

PREPARING THE WAY

Discuss the questions.◼ What would be your ideal job?◼ What makes a job fun?◼ What is the purpose of work experience?

ACTIVITY 1

Look at the two pictures below. Answer the questions.

1 What is happening in each picture?

2 How do you think the people are feeling?

3 Have you ever had a job interview? If so, what was it like?

Assessment Objective 3A

Understand the overall message of a spoken passage

Assessment Objective 3B

Identify essential and finer points of detail in spoken material

M03_EESL_SB_IGCSE_88948_U03_068-105.indd 70 12/07/2017 15:40

The ESL course supports teachers and learners through cumulative language acquisition and encourages inter- and intra-personal as well as cognitive skills. The skills needed to meet the examination assessment objectives are explicity taught and practised. The course promotes learner autonomy, for example, through the Writing and Grammar reference included, and is supported by a Teacher’s Book.

A range of fun activities and grammar games in the Grammar and Vocabulary checkpoints provide practice for language points which are carefully picked to be suitable to the theme. An emphasis is placed on word building skills.

The initial part of the chapters are divided into Preparing the Way, where learners practice relevant language and contextualise, and Focusing on the Exam / Exam refreshers which provide detailed guidance of what to expect, and how to prepare for the exam throughout. Then students practice one part of the paper in Practice Time.

The ESL Online Audio Pack includes all recordings and scripts for the listening exercises. These resource are all downloadable.

56

Student Books (English Language and Literature)

311reading skills text analysis 311PaPer 2 literary heritage texts

symbolic where a person, object or event is used by a writer to convey a meaning beyond its literal meaning

static not moving; fixed

The Scarlet Letter that hangs around Hester’s neck is also a symbol. Indeed, it is a symbol that is repeated at significant points in the plot. First, it is repeated in the letter ‘A’ that the meteor makes in the sky as Hester, Dimmesdale and Pearl stand on the scaffold. Much later, it is repeated again in the letter ‘A’ carved on Hester and Dimmesdale’s shared grave. The ‘A’ is a particularly interesting symbol because its meaning changes. It starts off as a symbol of Hester’s crime and sin, but by the end of the novel it serves instead as a symbol of her goodness. This shows that, while some symbols are static and have fixed meanings, Hawthorne is also interested in the way that the meaning of symbols can shift and become a site of conflict. For example, when Hester uses her embroidery skills to make the letter beautiful and therefore contradict its original Puritanical purpose, this is a sign of this symbolic conflict.

activity 4

▼ understanding the text

Pick a theme of The Scarlet Letter and list the ways in which Hawthorne uses symbolism to communicate it. For example, you could say, ‘The theme of the restrictiveness of Puritan society is communicated through symbols of punishment, such as the prison, the scaffold and Hester Prynne’s scarlet letter.’

1 Compare and contrast the characters of Roger Chillingworth and Arthur Dimmesdale. You must consider language, form and structure and refer to the context of the novel in your answer. (30 marks)

2 How does Hawthorne explore the conflict between society and the individual in The Scarlet Letter? You must consider language, form and structure and refer to the context of the novel in your answer. (30 marks)

3 Explore the relationship between Hester Prynne and Pearl. You must consider language, form and structure and refer to the context of the novel in your answer. (30 marks)

4 What is the significance of silence or the refusal to speak in The Scarlet Letter? You must consider language, form and structure and refer to the context of the novel in your answer. (30 marks)

5 Explore the significance of symbols in The Scarlet Letter. You must consider language, form and structure and refer to the context of the play in your answer. (30 marks)

10th

5 There are a wide range of symbols present within The Scarlet Letter, making symbolism a very important technique for Hawthorne. 1 the use of visual symbols often associated with nature allows for character development and the introduction of interesting metaphors. An example of this is Pearl who has grown up away from civilised society and is much closer to nature, making her a vibrant character. 2 In contrast, the scaffold is a clear symbol of death within the story. 3 the letter from the book’s title is another reccurring symbol 4, described by the narrator as ‘a mystic symbol’. by calling it this, the reader can understand that it is not just a symbol of shame as the townspeople want, but also has different meanings.

subJect vocabulary

general vocabulary

AO1

In the exam, you will have 45 minutes in which to write your essay. There will be a choice of two questions on the paper. Use these exam-style questions to practise exam technique and timing. Remember to consider language, form and structure and refer to the context of the novel in your response.

hint

skills critical thinking, analysis, reasoning, interPretation

AO1 AO2 AO4

skillscritical thinking, analysis, reasoning, interPretation, adaPtive learning

exam-style questions

1 AO1: This opening shows an understanding of text overall in relation to the question.2 AO2: To comment more closely on Hawthorne’s technique, could be it explained how she is a symbol?3 AO2: It is a good idea to mention a few relevant points in the introduction, before writing about them in detail later on. Can you think of any more symbols that could have been included?4 AO1: For good written style, you might need to think of synonyms for key words in the question. Can you think of any synonyms for ‘symbol’?

M04_ENGL_SB_2588_U04.indd 311 30/09/2016 10:57

Unc

orre

cted

pro

of, a

ll co

nten

t sub

ject

to c

hang

e at

pub

lishe

r dis

cret

ion.

Not

for r

esal

e, c

ircul

atio

n or

dis

tribu

tion

in w

hole

or i

n pa

rt. ©

Pea

rson

201

7

PAPER 1 TRANSACTIONAL WRITING200

When you read a text, you probably expect the opening to be interesting, and to grab your attention in some way. The following table lists some effective techniques that you can use to improve your openings. Which technique you use will depend on the task.

▼ TECHNIQUE ▼ EXAMPLEA rhetorical question ‘How often do you take action when you feel something ought to be done?’

An arresting or controversial statement ‘It’s not children who need educating about recycling – it’s the grown-ups who ought to know better.’

A surprising or shocking fact or statistic ‘The unreleased energy contained in the average dustbin each year could power a television for 5,000 hours.’

A relevant quotation ‘We live in a disposable society. It’s easier to throw things out than to fix them.’

A short and relevant anecdote ‘I have found it saves money to reuse the plastic containers…’

LEARNING OBJECTIVESThis lesson will help you to:

◼ understand how to write effective openings and conclusions to your writing.

OPENINGS AND CONCLUSIONS

OPENINGS

HINT

Remember that your statistics do not have to be accurate in the exam; they just have to sound plausible. However, if you are writing for homework, you should check that your statistics are correct. Write two possible openings to a response to the following question.

▶ Write an article arguing for or against the proposal that the smacking of children should be made illegal.

▼ USING DIFFERENT KINDS OF OPENING

ACTIVITY 1

One of the benefits of planning is that you are less likely to write a weak or uncertain opening because you have thought about what you are going to write. A mistake that students can make if they have not planned their response is to simply repeat words from the question with a phrase such as, ‘In this article I am going to write about…’. Since your reader already knows this, it is a waste of time and is uninteresting.

SKILLS PROBLEM SOLVING, ADAPTIVE LEARNING, CREATIVITY

KEY POINT

The pressure of getting started can often lead to a bland opening, written just to get something on the page. It pays to resist this pressure and think through your first words.

AO5AO4

M04_Chapter3_ENGA_SB_2564_U04.indd 200 12/12/2016 15:45Sample pages taken from Edexcel International GCSE (9–1) English Language A

Sample pages taken from Edexcel International GCSE (9–1) English Literature

Subject vocabulary and General vocabularyUseful words and phrases are colour coded within the main text and picked out in the margin with concise and simple definitions. These will support understanding of key subject terms and support students whose first language is not English.

Pearson ProgressionSample student answers have been given a Pearson Step from 1 to 12. This tells you how well the response has met the criteria in the Pearson Progression Map.

HintUseful support and advice addressingcommon mistakes or difficult content.

SkillsEach activity and set of questions has been assigned with the key skills gained from undertaking them, allowing for a strong focus on particular academic qualities.

ActivitiesA wide range of varied activities to encourage understanding and embed understanding as an individual, as well as in larger groups to establish cross-peer learning and communication.

Exam-style questionsQuestions tailored to the Pearson Edexcel specification to allow for practice and development of exam writing technique.

Learning objectivesChapters and Units are carefully tailoredto address key assessment objectivescentral to the course.

ENG

LISHAG

ES 14–16


Online Teacher Resource Packs


If you like this, you may also like...Edexcel International GCSE (9–1) is available for a range of subjects (see page 10).

Screenshot taken from Edexcel International GCSE

(9–1) English Literature Teacher Resource Pack.

The Edexcel International GCSE (9–1) Online Teacher Resource Packs are annual subscriptions containing material to support your planning and teaching and save you valuable time. They include:

l lesson plans

l worksheets

l slide decks

lpractice exam papers.

EDEXCEL INTERNATIONAL GCSE (9–1) ENGLISHTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

ENGLISH LANGUAGE A & BEnglish Language A Student Book and ActiveBook

978 0 435182 56 4

English Language A Online Teacher Resource Pack

978 0 435188 96 2

English Language B Student Book and ActiveBook

978 0 435182 57 1

English Language B Online Teacher Resource Pack

978 0 435188 97 9

ENGLISHLITERATUREEnglish Literature Student Book and ActiveBook

978 0 435182 58 8

English Literature Online Teacher Resource Pack

978 0 435189 15 0

ENGLISH AS A SECOND LANGUAGEEdexcel International GCSE (9-1) ESL Student Book and ActiveBook

978 0 435188 94 8

Edexcel International GCSE (9-1) ESL Teacher Book

978 0 43518895 5

Edexcel International GCSE (9-1) ESL Online Audio Pack

978 0 435191 68 9

REVISIONSUPPORTOur revise titles support all International GCSE and GCSE courses www.pearsonglobalschools.com/reviseGCSERevise GCSE Study Skills Guide 978 1 447967 07 1Revise GCSE Revision Planner 978 1 447967 82 8Revise GCSE Spelling, Punctuation and Grammar Revision Guide

978 1 292211 52 7


978 1 292211 49 7

58

Edexcel GCSE (9–1) English Language

Designed specifically for the new Pearson Edexcel GCSE (9-1) English Language specification, our endorsed resources will help you prepare your students for the more demanding content and higher expectations of the new GCSE in English Language.

Is it for me?l Fully prepares all students for the new style of

assessments.

l Monitors students’ progress and predicts success simply and effectively via the ActiveLearn Digital Service, so you can check they are on track.

l Improves students’ writing skills with an evidence-based approach so that they can write in a sustained, technically accurate and effective way.

l Develops student confidence and resilience when responding to challenging unseen texts with the Let’s Think in English pedagogy.

l Helps you use the Grammar for Writing and Let’s Think in English pedagogies to full effect.

Summary of componentsl 1 Text Anthology

l ActiveBook institutional licences (one-year licences hosted on ActiveLearn Digital Service) – 5 licence options: up to 5-users, up to 10-users, up to 15-users, up to 20-users, up to 50-users, up to 75-users, or up to 150-users

l ActiveLearn Digital Service (annual subscription) – with five, one-year subscription licence options for schools of varying sizes

l 6 Intervention Workbooks

l 1 Revision Guide

l 1 Revision Workbook


Contains audio


ENG

LISH LA

NG

UA

GE

AGES 14–16

59

HOW TO SAMPLEEvaluate with a free 60-day trial of ActiveLearn Digital Service (includes access to the Teacher Guide, ActiveBook and the Homework Practice and Support Service), go to www.pearsonglobalschools.com/ALDStrial, select the programmes you would like to sample and complete your details on the form. Please allow 7 UK working days for the trial to be set-up.

www.pearsonglobalschools.com/gcseenglish

EDEXCEL GCSE (9-1) ENGLISH LANGUAGE To place an order for ActiveLearn Digital Service and ActiveBooksStep 1: Identify which tier your school size matches. Small school is fewer than 100 pupils Medium school is 101-300 pupils Large school is 301-500 pupils Extra Large school is 501-999 pupils Super school is 1000+ pupilsStep 2: Select the ISBNs you want access to. These can be found under the component section of each product page.Step 3: Complete the International digital subscription order form at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

ACTIVELEARN DIGITAL SERVICEActiveLearn Digital Service 1-Year Subscription, INTERNATIONAL SMALL

978 1 292137 12 4

ActiveLearn Digital Service 1-Year Subscription, INTERNATIONAL MEDIUM

978 1 292137 11 7

ActiveLearn Digital Service 1-Year Subscription, INTERNATIONAL LARGE

978 1 292137 10 0

ActiveLearn Digital Service 1-Year Subscription, INTERNATIONAL EXTRA LARGE

978 1 292137 09 4

ActiveLearn Digital Service 1-Year Subscription, INTERNATIONAL SUPER

978 1 292137 13 1

STUDENT RESOURCESEdexcel GCSE (9-1) English Language Text Anthology

978 1 447982 04 3

Text Anthology ActiveBook Subscription, INTERNATIONAL SMALL

978 1 292137 07 0

Text Anthology ActiveBook Subscription, INTERNATIONAL MEDIUM

978 1 292137 06 3

Text Anthology ActiveBook Subscription, INTERNATIONAL LARGE

978 1 292137 05 6

Text Anthology ActiveBook Subscription, INTERNATIONAL EXTRA LARGE

978 1 292137 04 9

Text Anthology ActiveBook Subscription, INTERNATIONAL SUPER

978 1 292137 08 7

REVISE Edexcel GCSE (9-1) English Language Revision Guide (with online edition)

978 1 447988 08 3

REVISE Edexcel GCSE (9-1) English Language Revision Workbook

978 1 447987 89 5

INTERVENTION WORKBOOKSTARGET GRADE 3 Reading Workbook 978 0 435183 25 7Writing Workbook 978 0 435183 28 8TARGET GRADE 5Reading Workbook 978 0 435183 26 4Writing Workbook 978 0 435183 29 5TARGET GRADE 9Reading Workbook 978 0 435183 27 1 Writing Workbook 978 0 435183 30 1

PROGRESSION SERVICES ENGLISHOur progression tools and resources are integrated into our ActiveLearn Digital Service. You can also use Pearson Progression Services alongside your own method, for a whole subject (11-16) or for the whole school across multiple subjects. We have a wide range of purchase options available. For more details, ISBNs and prices, visit www.pearsonglobalschools.com/progression services.

Pearson Global Schools website


l Access to samples, free trials and demos to evaluate resources online

lFull component listings, along with downloadable structure charts and overview videos

lWrite your own product review and tell us what you think about our resources.

9:45 AM 100%iPad

60

New Windmills

New Windmills is a name you know and trust. With over 200 titles, award-winning authors and a staggering variety of novels and plays, New Windmills has long been the first choice for literature in English classrooms. We have brought together our Heinemann and Longman titles into the New Windmills family to provide you with the best collection of titles for 11-19 and beyond.

Where else will you find novels and authors such as Nina Bawden, Anthony Horowitz and Michael Morpurgo in one place? Who else can bring you original plays and adaptations from authors such as Benjamin Zephaniah?

The first choice for literature in English classrooms

A novel by Patrick Ness From an original idea by Siobhan Dowd

A MONSTER CALLS

Good to know?FREE online teaching support available with some titles

ENG

LISH LITERA

TURE

AGES 11–14

61www.pearsonglobalschools.com/literature

Bestselling and award-winning titles


Nina BawdenCarrie’s War For 30 years Carrie has not spoken of Druid’s Bottom where she and her brother sheltered from the war. The story unfolds of Carrie’s life under tyranny, her friendship with the strange inhabitants of Druid’s Bottom and an ancient curse.

Winner of the 1993 Pheonix Award %Hardback 978 0 435122 02 7

Anthony HorowitzStormbreakerThey told fourteen-year-old Alex Rider that his uncle died in a car accident, but bullet holes in the windscreen tell a different story. Alex’s search for answers soon drags him into the deadly world of MI6 and his first mission: investigate Stormbreaker...

Children’s Book Award Shortlist %Hardback 978 0 582848 75 7 *

Joan LingardAcross the BarricadesIn Belfast, at a time when the fear and suspicion between Catholics and Protestants is deep and violent. For Protestant Sadie and Catholic Kevin there are many many problems – and no easy solutions.

Winner of the West German Award %Buxthuderbulle

Hardback 978 0 435122 03 4

Michael MorpurgoKensuke’s KingdomMichael’s family are on the adventure of a lifetime, sailing around the world in their yacht, the Peggy Sue. But when Michael falls overboard and is washed up on a remote island, he must learn to survive on his own. Until he discovers he is not alone…

Winner of the Red house Children’s %Book Award

Hardback 978 0 435125 29 5

Patrick NessA Monster CallsThe monster showed up just aftermidnight. But it isn’t the monsterConor’s been expecting - the onefrom the nightmare he’s had nearlyevery night since his mother startedher treatments. This monster issomething different and it wants themost dangerous thing of all fromConor. It wants the truth.

Winner CILIP Carnegie medal %Winner CILIP Kate Greenaway medal %Winner Children’s Book Galaxy National %Book Awards

Winner Red House Children’s Book Award %Hardback 978 0 435161 52 1 *

George OrwellNineteen Eighty- Four

Big Brother, Thought Police, Newspeak, the Ministry of Love - in George Orwell’s Nineteen Eighty-Four the party controls every aspect of life. But Winston still remembers a time before the revolution - a time when men and women lived by instincts and loved with passion. He thinks he is alone in his ‘thought-crimes’ but then he meets Julia.

978 0 435123 57 4

Erich Maria RemarqueAll Quiet on the Western FrontThe impact of this astonishing novel about the First World War is as great as ever. In it the distinguished German author tries, in his own words, ‘simply to tell of a generation of men, who even though they may have escaped its shells were destroyed by the war.’

978 0 435121 46 4

A novel by Patrick Ness From an original idea by Siobhan Dowd

A MONSTER CALLS

62

Plays and Collections

Robert SwindellsStone ColdHomeless on the streets of London,14-year-old Link feels he has becomean outcast. Streetwise Ginger, makeslife more bearable as he learns thetricks of survival. Until Ginger andother homeless kids disappear.

Carnegie Medal Winner %Hardback 978 0 435124 68 7

Robert WestallThe Machine GunnersIt is 1940 in Tyneside. A German Heinkel bomber has been shot down during an air raid. Somehow, someone has got away with a working machine gun and all its ammunition from the crashed plane. But who? And what will they do with the gun?

Carnegie Medal Winner %Hardback 978 0 435124 57 1

Benjamin ZephaniahGangsta RapPermanently excluded from school, Ray and his friends form a rap group and sign a record deal. But the gangsta style gets them mixed up with real gangster action... This edition has been edited in consultation with teachers.

Hardback 978 0 435125 62 2

Adrian Flynn/Michele CelesteBurning Everest and Mariza’s StoryTwo powerful plays which explore the impact of children suddenly being separated from their parents.

Winner of the W.H.Smith Plays for %Children Award

Age 12+

Hardback 978 0 435233 08 2

Benjamin Zephaniah and Richard ConlonBased on the novel byBenjamin Zephaniah

FaceThis play deals with issues such as prejudice, drugs and disfigurement in this vibrant, gritty adaptation of Zephaniah’s bestselling novel.Age 11+

Hardback 978 0 435233 44 0

Roy Blatchford Different CulturesA rich collection of short stories from around the world covering themes from childhood, prejudice, conflict and values. Stories include: My Simple Little Brother and the Great Aversion Therapy Experiment, Norman; Rules of the Game, Tan; The Wardrobe, the Old Man and Death, Ribeyro; Big Bill, Ray; The Liar, Anand.

Hardback 978 0 582488 50 2 *

ENG

LISH LITERA

TURE

AGES 11–14


Susan HillThe Woman in BlackWhen Arthur Kipps, a young up-and-coming solicitor, was sent up north to attend the funeral of Mrs Alice Drablow nothing prepares him for the terrible event he was about to witness at Eel Marsh House.

978 0 582026 60 5

GCSE Set Text: Edexcel, WJEC

Witi IhimaeraThe Whale RiderA mystical story of Maori culture The birth of a daughter - Kahu - breaks the lineage of a Maori tribe. Rejected by her grandfather, Kahu develops the ability to communicate with whales, echoing those of the ancient Whale Rider after whom she was named. This magical and mythical novel tells of the conflict between tradition and heritage. Ideal for studying multi-cultural texts, gender and environmental issues. The beautifully poetic style and twin narrative lends itself to the analysis of language.

978 0 435131 0 81

Edexcel International GCSE (9–1) Set Text

Harper LeeTo Kill a MockingbirdScout, the keen-eyed teller of the story, and her brother Jem interrupt their games to champion their lawyer father when, in a hostile, racist town in the American South, he battles to defend Tom Robinson who is black and accused of attempted rape.

978 0 435120 96 2


George OrwellAnimal FarmLed by the pigs Napoleon and Snowball, the animals drive out Farmer Jones from Manor Farm. They set up an Animals’ Republic in which all are to be free and equal. But the expected saviours turn out to be as greedy, vain and oppressive as the original tyrants.

Heinemann ed 978 0 435121 65 5 Longman ed 978 0 582434 47 9

GCSE Set Text: AQA, Edexcel, OCR

Set texts for GCSE, International GCSE, A level and International A Level

J.B. PriestleyAn Inspector CallsBESTSELLER

A caller shatters a family’s complacency by implicating each member in Eva Smith’s death.

978 0 435232 82 5

GCSE Set Text: AQA, Edexcel, OCR, WJEC Edexcel International GCSE English Literature (9–1) Set Text

Carlos Ruiz ZafónThe Prince of MistMax Carver’s new life on the coast plunges him into a mystery that has been unfolding for generations. With his new friend he explores the wreck of a boat that sank many years ago in a terrible storm. Everyone on board perished except for one man - an engineer who built the lighthouse at the end of the beach. During the dive, Max sees something that leaves him cold, and as he learns more about the wreck, the chilling story of the Prince of Mist begins to unravel.

978 0 435045 92 0

If you like this, you may also like...York Notes, the nation’s favourite Literature Study Guides. Help your students get the best grade possible with the UK’s bestselling Literature Guides. Packed full of features to help students get to grips with a text quickly, York Notes are now firmly established as the nation’s favourite and most comprehensive literature study guides. Learn more at www.pearsonglobalschools.com/yorknotes

64


Chinua AchebeThings Fall ApartOkonkwo, a man of the Ibo tribe in Nigeria at the end of the last century, is a person of substance, character and promise. But he and his people are doomed to be destroyed – from within by the superstition-bound customs of tribal life, and from without by the arrival of the white man. A classic of modern African writing.

Winner of International Man %Booker Prize 2007.

978 0 435121 62 4


Emily BrontëWuthering HeightsThe tragic tale of Cathy and Heathcliff, set in the wild moors of the North of England. Includes an introduction, notes and activities to enhance students’ understanding of the novel. This title is unabridged.

978 0 435126 08 7

Edexcel A Level Set Text Edexcel International A Level Set Text

Charles DickensA Christmas CarolOne of a series of top-quality fiction for schools, this is Dickens’s Christmas story about Scrooge, a tight-fisted old miser who refuses to celebrate Christmas.

978 0 435124 05 2

GCSE Set Text: Edexcel

George EliotSilas MarnerSilas Marner has lived in Raveloe for years, but he remains alone, a weaver mistrusted by the village people. Then Eppie arrives and changes his life forever. Includes an introduction, notes and activities to enhance students’ understanding and enjoyment of the novel. This title is unabridged.

978 0 435126 0 49

GCSE Set Text: Edexcel

Margaret AtwoodThe Handmaid’s TaleThe Republic of Gilead offers Offred only one function: to breed. If she deviates, she will, like dissenters, be hanged at the wall or sent out to die slowly of radiation sickness. But even a repressive state cannot obliterate desire - neither Offred’s nor that of the two men on which her future hangs.

978 0 435124 09 0

A Level Set Text: AQA, Edexcel

Jane AustenPride and PrejudiceJane Austen’s wry view of the ‘civilised’ society of her time underpins a tale of misunderstandings and romance.This title is unabridged.

Heinemann ed 978 0 435126 07 0

GCSE Set Text: AQA, Edexcel, WJEC Edexcel International GCSE English Literature (9–1) Set Text

Charlotte BrontëJane EyreHeinemann ed 978 0 435126 02 5 Longman ed 978 0 582077 19 5

GCSE Set Text: AQA, Edexcel, OCR, WJEC A Level Set Text: OCR, WJEC

Charles DickensGreat ExpectationsLongman editionA chance encounter with an escaped convict and an unexpected summons from the mysterious Miss Havisham changes the life of the orphan Pip.

Heinemann ed 978 0 435126 00 1 Longman ed 978 0 582077 83 6

GCSE Set Text AQA Edexcel International GCSE English Literature (9–1) Set Text

ENG

LISH LITERA

TURE

AGES 11–18


Longman School ShakespeareRomeo and JulietShakespeare’s famous story of the “star-crossed” lovers. Teenagers Romeo Montague and Juliet Capulet fall deeply in love then discover that their families are bitter enemies. They marry in secret, despite the feud between their families and, even though they try to conceal their actions, their story ends in tragedy.

978 1 408236 89 5


Longman School ShakespeareThe Merchant of VeniceShylock, a greedy Jewish money-lender, agrees to make a short-term loan to a Venetian Merchant, Antonio. During this time, Shylock’s daughter elopes. When Antonio fails to pay the debt in time, Shylock, who is intent on seeking revenge for his daughter’s actions, demands his pound of flesh. A trial of wits ensues and the unfortunate Shylock ends by renouncing his faith and his fortune.

978 1 408236 90 1


Longman School ShakespeareMacbethWhen three witches predict that Macbeth, will one day become king of Scotland, he decides that he will murder the then ruler, King Duncan. Macbeth’s wife supports his plan and helps him by smearing Duncan’s blood on the daggers of the sleeping guards. Macbeth becomes king but more murders ensues and, while the ghost of Banquo begins to appear to Macbeth, his wife’s conscience tortures her until she commits suicide.

978 1 408236 86 4


Longman School ShakespeareMuch Ado about NothingTwo young lovers, Claudio and Hero, are set to be married but resenting the celebrations, Don John seeks a way to spoil their happiness and plots to thwart the nuptials.

978 1 408236 87 1


New Longman ShakespeareTwelfth NightOrsino, Duke of Illyria, is in love with a neighbouring countess, Olivia, and sends his new page, who is in fact a shipwrecked woman disguised as a man, to woo her.

978 0 582365 78 0

AS & A Level Set Text: AQA GCSE Set Text: Edexcel

Longman School ShakespeareOthello978 1 408236 88 8

GCSE Set Text: WJEC A Level Set Text: AQA, Edexcel

Shakespeare set texts for GCSE, International GCSE, A level and International A Level

Longman School ShakespeareThe Tempest978 0 582848 66 5

GCSE Set Text: AQA, Edexcel A Level Set Text: WJEC

66

Dynamo

Your KS3 path to GCSE success

NEW

Is it for me?l Builds key language skills at KS3 (11-14) providing

a seamless transition to our GCSE (9–1) French courses, ensuring pupils are ready for the demands of the new GCSE.

l A robust and pupil-friendly approach to the challenges of learning grammar, promoting active engagement and building on logical progression.

l Gives your pupils a real taste of French culture, with up-to-date resources that brings language learning to life.

l Our proven approach to differentiation, included in both our print and interactive digital resources, enables pupils of all abilities to progress.

l Easy-to-customise assessments that help you monitor and report progress and help your pupils familiarise themselves with GCSE-style tasks.

l Fully integrated with our ActiveLearn Digital Service.

Summary of componentsl 5 x Pupil Books

l 5 x ActiveBook subscriptions, includes access to audio

l 5 x ActiveLearn Digital Service subscriptions to suit the size of your school

l 5 x Teacher Guides

l 3 x Assessment Packs

l 5 x Audio, available to buy separately as a download

l 6 x Workbooks

Dynamo is our brand-new course for KS3 French, with up-to-date cultural content and an active approach to learning grammar it will motivate and engage your students.

See page 69 for a full list of titles, ISBNs and prices.

LAN

GU

AG

ESAG

ES 11–14

67www.pearsonglobalschools.com/dynamo

What’s special?

Support 11–16 progression in your subject with ActiveLearn Bringing together your planning, teaching and assessment across one service, Dynamo is fully integrated with ActiveLearn Digital Service, saving you valuable time and providing you with all you need to assist you and your learners. ActiveLearn Digital Service (ALDS) contains:

Complete support for planning, teaching and assessment

En classe (Pupil Book pp. 32–55)2

© Pearson Education Ltd 2018. Copying is permitted by the purchasing institution for teaching purposes only. No other copying or reproduction permitted without express permission of Pearson Education. 1

Unit & Learning objectives

Programme of Study coverage (PoS)Pearson Progression Step Coverage (PPS)

Key language Grammar (G) and Skills coverage

Quiz about school in the French-speaking world(pp. 32–33)

Using knowledge of cognates

Comparing the French and British school systems

Point de départ(pp. 34–35)

Talking about colours

Telling the time

PoSGV3 Developing vocabulary

LC7 Literary texts

LC8 Writing creatively

PPS: 1st–3rd Step

Ici il y a …un cercleun demi-cercleun triangleblanc(he)bleu(e)gris(e)jaunemarronnoir(e)orangeroserougevert(e)violet(te)en basau centreà droiteà gaucheQuelle heure est-il?Il est …cinq heurescinq heures dix / vingtcinq heures et quartcinq heures et demiecinq heures moins dix / vingtcinq heures moins le quartmidi / minuit

Using context and cognates to decode words

Using a dictionary to check genders

Pronunciation of silent‘h’ in heures and silent ‘s’ at the end of words

Difference between il est neuf heures andà neuf heures

1 Qu’est-ce que tu penses de tes matières?(pp. 36–37)

Saying what you think of your school subjects and why

Talking about likes and dislikes using –er verbs

PoSGV3 Opinions and discussions

LC5 Accurate pronunciation and intonation

PPS: 3rd–5th Step

Qu’est-ce que tu penses de tes matières?le françaisle théâtrela géographiela musiquela technologiel’anglaisl’EPSl’histoirel’informatiqueles arts plastiquesles maths

Using a range of verbs to express opinions: aimer, adorer, détester

Using ne … pas with aimer

Pronunciation of j’aimeand tu aimes

Using parce que to give reasons for your opinions

DRAFTContrôleModule 2 Dynamo 1Nom

Speaking 1A Can you say these subjects in French? (1st Step)

Example:

1 2 3 4

B Answer these questions about school. (2nd–3rd Step)1 Tu aimes le français? (Oui, j’aime / Non, je n’aime pas ...)

2 Qu’est-ce que tu portes au collège? (Je porte …)

3 Tu arrives au collège à quelle heure? (J’arrive à …)

4 Qu’est-ce que tu fais à midi? (À midi, je mange / je joue / je chante ... )

C Look at the photo and answer the questions. (3rd–5th Step)

1 Qu’est-ce qu’il y a sur la photo? (Sur la photo, il y a …)

2 Qu’est-ce que tu penses de ton uniforme scolaire? (Je pense que c’est ....)

3 Ta journée scolaire est comment? (D’abord, je quitte la maison à …)

4 Tu aimes les maths? Pourquoi (pas)? (J’aime / Je n’aime pas les maths parce que … )

les sciences

© Pearson Education Ltd. 2018. Copying is permitted by the purchasing institution for teaching purposes only.No other copying or reproduction permitted without express permission of Pearson Education.

InDesign 'Word' template.indd 2 19/03/2018 11:50

DRAFT

Front-of-class teaching resources

See pages 8–9of this Course Guide

Online homework

and practice exercisesSee page 10

Progression and

assessment materialsSee page 13

Teacher planning materialsSee page 12





Online homework

and practice exercisesSee page 10

Online homework

and practice and practice exercisesSee page 10






Progression and

assessment materialsSee page 13

Progression and

assessment assessment materialsSee page 13

and practice and practice and practice assessment

Progression

assessment assessment ActiveLearn Digital Service

If your school is an existing Studio KS3 French ActiveLearn subscriber and you’d like to speak to us about your options, please get in touch at pearsonschools.co.uk/dynamo

Dynamo Components.indd 2-3 9/11/18 3:48 PM

Our detailed 5-year Schemes of Work are fully customisable to aid your planning and progression to GCSE.

Evaluate our resources at your own paceGo online to download free samples and access our customisable Scheme of Work at www.pearsonglobalschools.com/dynamo

Sample from Dynamo 1, Teacher Guide

Sample from Dynamo 1, Assessment Pack

Teacher Guides and Assessment Packs are available within ActiveLearn, or to purchase separately as a download.

68

How does it work? Dynamo KS3 French course has been purposefully designed to build the skills needed to progress to GCSE and beyond. It is embedded with ongoing assessment and support that reflects the style of the new GCSE.

Module 2

32 33trente-deux trente-trois

En classe

Je commence à 8 heures.

Il y a une cantine.Il y a un uniforme scolaire.

Il y a des cours d’éducation religieuse.

On n’a pas cours le mercredi après-midi.

Les parents paient l’équipement scolaire.

C’est quelle personne?08:001

In France, schools often have the name of a famous historical person. Which famous historical person would you name your school after?

What do you think about the differences? Do you prefer the French or the British system?

Collège Vincent van Gogh Collège Claude Debussy Collège Marie Curie

Collège Victor Hugo Collège Charles de GaulleCollège Jeanne d’Arc

Use your knowledge of cognates to work out what school subjects are on this timetable. Can you apply the pronunciation rules you know to read the timetable aloud in French?

8h 9h 10h 10h10 11h20 12h20 13h50 14h50 15h50

sciences géographie récréation maths théâtre déjeuner musique sport informatique

c

e

b

d f

ancien président

écrivainartiste scientifique

a

compositeur soldat et sainte

1

52

3

4

6

1

5

3

7

2

6

4

8

What do you think récréation and déjeuner are?

Qu’est-ce que c’est en anglais?

Au collège. En France, en Grande-Bretagne ou les deux?

À la cantine! C’est quel plat?

1 2 3

4 5 6

carottes râpées

salade au brie et aux raisins

*** filet de poisson sauce

à la crème

couscous poulet

ratatouille

haricots verts***

flan à la vanille

yaourt nature

Menu du 21 novembre

ab

f

h

g

d

c

e2

3

4

DRAFT

DRAFT

MODULE 2

2 Qu’est-ce que tu portes?

This worksheet is © Pearson Education Limited 2018. Copying is permitted by the purchasing institution for teaching purposes only. No other copying or reproduction permitted without express permission of Pearson Education.

Page 1 of 1

Grammar quiz: Adjectives

A Put the words in the correct order to translate the English into French.

1 a purple polo shirt polo un violet __________________ 2 green trainers vertes des baskets __________________ 3 blue trousers bleu pantalon un __________________ 4 a white skirt une blanche jupe __________________

B Work with a partner to write these adjectives in the correct part of the diagram.

C Which option (A or B) is correct?

A B Answer

1 un tee-shirt gris un tee-shirt grise A

2 un sweat rouges un sweat rouge

3 des baskets blanche des baskets blanches

4 une cravate bleue une cravate bleu

5 des chaussettes noirs des chaussettes noires

6 une jupe verte une jupe vert

Most adjectives, including colours, come after the noun.

violet rose bleue rouge blanche

noir verte jaune gris

masc. singular un pull vert

fem. singular une jupe verte

masc. plural des polos verts

fem. plural des chaussures vertes

If an adjective already ends in –e, the feminine form stays the same. blanc is irregular: un pull blanc /

une jupe blanche

masculine feminine both

Dyn

amo 1

© P

ears

on

Educ

atio

n Li

mited

20

18

2

Cahier AModule 22 Qu’est-ce que tu portes? (pages 38-39)

1 Write the correct letters in the boxes to match the French words to the pictures.

2 Look at the picture, then unjumble the letters to complete the sentences.

3 Choose four sentences from exercise 2 and write the English translations.

1 un pantalon 4 un pull 7 des chaussures

2 noir 5 des chaussettes 8 une chemise

3 blanc 6 gris 9 une cravate

18

d e

f g h i

a b c

1 Je porte une cravate . (rgsie)

2 Je porte une chemise . (lbnhcae)

3 Je porte un pull . (sgir)

4 Je porte un pantalon . (roin)

5 Je porte des chaussettes . (asblnche)

6 Je porte des chaussures . (nersio)

grise

C

French adjectives normally come after the noun: une cravate noire

They also agree with the noun:

masculine feminine

singular noir noire

plural noirs noires

blanc is irregular: blanc / blanche / blancs / blanches

Des means ‘some’. You don’t always need to include ‘some’ in English.

DRAFT

Sample from Dynamo 1, Year 7 Pupil Book

Samples from Dynamo 1, Workbook A.

Sample from Dynamo 1, Year 7 Pupil Book

Culturally up to date French content ensures all topics are looked at through a cultural lens, with units in every module looking at day-to-day life in France and relevant cultural content (paintings, icons, poetry, etc).

Quizzes are in French, showing pupils how much they can understand through cognates and context.

Pupil-friendly grammar quizzes promote active engagement around manipulating grammar.

Workbooks provide activities to go with all key teaching spreads in the Pupil Book. They include pages dedicated to grammar practice and building skills for GCSE.

Grammar is introduced simply with clear colour coding to highlight rules. Further practice is provided in the grammarpages at the end of each module.

LAN

GU

AG

ESAG

ES 11–14

69www.pearsonglobalschools.com/dynamo

HOW TO EVALUATETry our ActiveLearn Digital Service with a free 60-day trial. Request online at www.pearsonglobalschools.com/ALDStrial

DYNAMO 11-14To place an order for ActiveLearn Digital Service and ActiveBooksStep 1: Identify which tier your school size matches. Small school is fewer than 100 pupils Medium school is 101-300 pupils Large school is 301-500 pupils Extra Large school is 501-999 pupils Super school is 1000+ pupilsStep 2: Choose the ISBNs you want access to (see below).Step 3: CComplete the international digital subscription order form and send this with your order via your usual ordering method. To download the international digital subscription order form, please visit www.pearsonglobalschools.com

STUDENT RESOURCESPUPIL BOOKSDynamo 1 Pupil Book 978 1 292226 31 6Dynamo 2 Rouge Pupil Book (available summer 2019)

978 1 292248 74 5

Dynamo 2 Vert Pupil Book (available summer 2019)

978 1 292248 79 0

Dynamo 3 Rouge Pupil Book (available summer 2020)

978 1 292248 86 8

Dynamo 3 Vert Pupil Book (available summer 2020)

978 1 292248 91 2

ACTIVEBOOK SUBSCRIPTIONSDynamo 1 ActiveBook Subscription INTERNATIONAL SMALL

978 1 292269 65 8

Dynamo 1 ActiveBook Subscription INTERNATIONAL MEDIUM

978 1 292269 64 1

Dynamo 1 ActiveBook Subscription INTERNATIONAL LARGE

978 1 292269 63 4

Dynamo 1 ActiveBook Subscription INTERNATIONAL EXTRA LARGE

978 1 292269 62 7

Dynamo 1 ActiveBook Subscription INTERNATIONAL SUPER

978 1 292269 66 5

Dynamo 2 Rouge ActiveBook Subscription INTERNATIONAL SMALL (available summer 2019)

978 1 292269 80 1

Dynamo 2 Rouge ActiveBook Subscription INTERNATIONAL MEDIUM (available summer 2019)

978 1 292269 79 5

Dynamo 2 Rouge ActiveBook Subscription INTERNATIONAL LARGE (available summer 2019)

978 1 292269 78 8

Dynamo 2 Rouge ActiveBook Subscription INTERNATIONAL EXTRA LARGE (available summer 2019)

978 1 292269 77 1

Dynamo 2 Rouge ActiveBook Subscription INTERNATIONAL SUPER (available summer 2019)

978 1 292269 81 8

Dynamo 2 Vert ActiveBook Subscription INTERNATIONAL SMALL (available summer 2019)

978 1 292269 85 6

Dynamo 2 Vert ActiveBook Subscription INTERNATIONAL MEDIUM (available summer 2019)

978 1 292269 84 9

Dynamo 2 Vert ActiveBook Subscription INTERNATIONAL LARGE (available summer 2019)

978 1 292269 83 2

Dynamo 2 Vert ActiveBook Subscription INTERNATIONAL EXTRA LARGE (available summer 2019)

978 1 292269 82 5

Dynamo 2 Vert ActiveBook Subscription INTERNATIONAL SUPER (available summer 2019)

978 1 292269 86 3

Dynamo 3 Rouge ActiveBook Subscription INTERNATIONAL SMALL (available summer 2020)

978 1 292269 90 0

Dynamo 3 Rouge ActiveBook Subscription INTERNATIONAL MEDIUM (available summer 2020)

978 1 292269 89 4

Dynamo 3 Rouge ActiveBook Subscription INTERNATIONAL LARGE (available summer 2020)

978 1 292269 88 7

Dynamo 3 Rouge ActiveBook Subscription INTERNATIONAL EXTRA LARGE (available summer 2020)

978 1 292269 87 0

Dynamo 3 Rouge ActiveBook Subscription INTERNATIONAL SUPER (available summer 2020)

978 1 292269 91 7

Dynamo 3 Vert ActiveBook Subscription INTERNATIONAL SMALL (available summer 2020)

978 1 292269 96 2

Dynamo 3 Vert ActiveBook Subscription INTERNATIONAL MEDIUM (available summer 2020)

978 1 292269 95 5

Dynamo 3 Vert ActiveBook Subscription INTERNATIONAL LARGE (available summer 2020)

978 1 292269 94 8

Dynamo 3 Vert ActiveBook Subscription INTERNATIONAL EXTRA LARGE (available summer 2020)

978 1 292269 93 1

Dynamo 3 Vert ActiveBook Subscription INTERNATIONAL SUPER (available summer 2020)

978 1 292269 97 9

TEACHER GUIDESDynamo 1 Teacher Guide 978 1 292248 67 7Dynamo 2 Rouge Teacher Guide (available summer 2019)

978 1 292248 75 2

Dynamo 2 Vert Teacher Guide (available summer 2019)

978 1 292248 80 6

Dynamo 3 Rouge Teacher Guide (available summer 2020)

978 1 292248 87 5

Dynamo 3 Vert Teacher Guide (available summer 2020)

978 1 292248 92 9

ACTIVELEARN DIGITAL SERVICE (ALDS) - INTERNATIONALDynamo 1 ActiveLearn Digital Service Subscription INTERNATIONAL SMALL FREE 60-DAY TRIAL

See online

Dynamo 1 ActiveLearn Digital Service Subscription INTERNATIONAL SMALL

978 1 292269 70 2

Dynamo 1 ActiveLearn Digital Service Subscription INTERNATIONAL MEDIUM

978 1 292269 69 6

Dynamo 1 ActiveLearn Digital Service Subscription INTERNATIONAL LARGE

978 1 292269 68 9

Dynamo 1 ActiveLearn Digital Service Subscription INTERNATIONAL EXTRA LARGE

978 1 292269 67 2

Dynamo 1 ActiveLearn Digital Service Subscription INTERNATIONAL SUPER

978 1 292269 71 9

Dynamo 2 ActiveLearn Digital Service Subscription INTERNATIONAL SMALL (available summer 2019)

978 1 292269 75 7

Dynamo 2 ActiveLearn Digital Service Subscription INTERNATIONAL MEDIUM (available summer 2019)

978 1 292269 74 0

Dynamo 2 ActiveLearn Digital Service Subscription INTERNATIONAL LARGE (available summer 2019)

978 1 292269 73 3

70

Dynamo 2 ActiveLearn Digital Service Subscription INTERNATIONAL EXTRA LARGE (available summer 2019)

978 1 292269 72 6

Dynamo 2 ActiveLearn Digital Service Subscription INTERNATIONAL SUPER (available summer 2019)

978 1 292269 76 4

Dynamo KS3 ActiveLearn Digital Service Subscription INTERNATIONAL SMALL (available summer 2020)

978 1 292270 01 2

Dynamo KS3 ActiveLearn Digital Service Subscription INTERNATIONAL MEDIUM (available summer 2020)

978 1 292270 00 5

Dynamo KS3 ActiveLearn Digital Service Subscription INTERNATIONAL LARGE (available summer 2020)

978 1 292269 99 3

Dynamo KS3 ActiveLearn Digital Service Subscription INTERNATIONAL EXTRA LARGE (available summer 2020)

978 1 292269 98 6

Dynamo KS3 ActiveLearn Digital Service Subscription INTERNATIONAL SUPER (available summer 2020)

978 1 292270 02 9

AUDIODynamo 1 Audio Files (Digital) 978 1 292248 65 3Dynamo 2 Rouge Audio Files (Digital) (available summer 2019)

978 1 292248 71 4

Dynamo 2 Vert Audio Files (Digital) (available summer 2019)

978 1 292248 83 7

Dynamo 3 Rouge Audio Files (Digital) (available summer 2020)

978 1 292248 84 4

Dynamo 3 Vert Audio Files (Digital) (available summer 2020)

978 1 292248 90 5

Evaluate Pearson Global Schools resources onlineMany of our resources are available to sample online. Evaluate resources at your own pace, anytime and anywhere.

www.pearsonglobalschools.com/onlinesampling

9:45 AM 100%iPad

WORKBOOKSDynamo 1 Workbook A Pack 978 1 292248 94 3Dynamo 1 Workbook B Pack 978 1 292248 95 0Dynamo 2 Rouge Workbook Pack (available summer 2019)

978 1 292248 97 4

Dynamo 2 Vert Workbook Pack (available summer 2019)

978 1 292248 96 7

Dnamo 3 Rouge Workbook Pack (available summer 2020)

978 1 292248 98 1

Dynamo 3 Vert Workbook Pack (available summer 2020)

978 1 292248 99 8

LAN

GU

AG

ESAG

ES 11–14

71

Studio

The complete language suite for 11-14 French

l A tried-and-tested approach that supports progression with parallel differentiated Pupil Books.

l Boost engagement with our online front-of-class teaching resources including the Pupil Books onscreen, video clips, audio and interactive activities.

l Helps pupils practise their language skills and use language independently in the classroom and at home.

l Provides complete coverage of the 2014 National Curriculum and embeds key skills ready for the new GCSEs.

French your pupils will want to learn

Studio 11-14 French moves at the right pace for your pupils and opens the window to the French-speaking world.

Components for each year:l Pupil Books, differentiated from Level 2

l Differentiated Workbooks

l ActiveLearn Digital Service subscriptions

l ActiveBook subscriptions

l KS3 Toolkit

Progression Service available

Visit www.pearsonglobalschools.com/languages for a full list of titles, ISBNs and prices.

12th

www.pearsonglobalschools.com/languages

72

Stimmt!

The complete language suite for 11-14 German

l A tried-and-tested approach that supports progression with parallel differentiated Pupil Books at level 3.




German your pupils will want to learn

Stimmt! 11-14 German resources are packed with content your pupils will enjoy learning. Plus, they move at the right pace and open the window to the German-speaking world.





l KS3 Toolkit



12th

LAN

GU

AG

ESAG

ES 11–14

73

¡Viva!

Spanish your pupils will want to learn

¡Viva! 11-14 Spanish resources are packed with content your pupils will enjoy learning. Plus, they move at the right pace and open the window to the Spanish-speaking world.

The complete language suite for 11-14 Spanish

l A tried-and-tested approach that supports progression with parallel differentiated Pupil Books at level 3.





LIB

RO

3R

OJO

T 0845 630 33 33F 0845 630 77 77

[email protected]

A LWAY S L E A R N I NG





l KS3 Toolkit



12th

74

Languages resources for the GCSE 9–1

l Resources designed to help students of all abilities reach their full potential.

l Support to understand the new assessments and to teach the skills required.

l Cultural content that motivates and brings languages to life.

l ‘Building blocks’ approach to grammar and vocabulary supports independent language use.

l Seamless transition from our popular Key Stage 3 courses.

Languages for all

Our French, German and Spanish resources for the 9–1UK GCSE qualifications build on progress made at Key Stage 3. They combine digital and print resources to prepare students for the new GCSE assessments – including the new focus on grammar, translation, understanding authentic and literary texts and speaking spontaneously.

Components for each language course:l Foundation and Higher Student Books

l Foundation and Higher ActiveBook subscriptions


l Grammar and Translation Workbook

l Vocabulary Book Pack of 8

l Intervention Workbooks

Progression Service availables


12th

HOW TO EVALUATEEvaluate with a free 60-day trial of ActiveLearn Digital Service (includes access to the Teacher Guide, ActiveBook and the Homework Practice and Support Service), go to www.pearsonglobalschools.com/ALDStrial select the programmes you would like to sample and complete your details on the form. Please allow 7 UK working days for the trial to be set-up.

LAN

GU

AG

ESAG

ES 14–16

75

ActiveBook and ActiveLearn Digital Service shown here are for medium-sized school subscriptions (101-300 students). For a details of each of the subscription options available for ActiveBook and ActiveLearn Digital Service, please visit www.pearsonglobalschools.com/languages.

ActiveLearn Digital Service Homework, Practice & Support Subscription, INTERNATIONAL MEDIUM 978 1 292177 12 0

Foundation Student Book 978 1 292117 82 9

Higher Student Book 978 1 292117 83 6

Foundation ActiveBook Subscription, 978 1 292179 08 7 INTERNATIONAL MEDIUM

Higher ActiveBook Subscription, 978 1 292179 09 4 INTERNATIONAL MEDIUM

Grammar and Translation Workbook 978 1 292132 99 0

Vocabulary Book Pack of 8 978 1 292133 46 1




































FOR

EDEX

CEL

FOR

AQ

A


76

KS3 Exploring History

Helping you build the foundations for success at GCSE, KS3 Exploring History is specifically designed to prepare your students for starting the Pearson Edexcel GCSE (9–1) History qualification.

Based on the Pearson Edexcel KS3 History scheme of work, this suite of resources is sure to inspire your young historians with enthralling narratives, sources, illustrations and activities.

The topics have been carefully chosen to provide key background knowledge for the units in the Pearson Edexcel GCSE course, without repeating content. GCSE-relevant skills (including new skills, like writing analytical narrative) are carefully built through the course.

Exploring History also works with the Pearson Progression Service to make tracking progress simple and accurate. Half-termly and end of year assessments with markbooks facilitate regular tracking of student progress, allowing you to identify strengths and weaknesses.

Supporting a two or three year deliveryThe accompanying teacher resources are designed to support a two or three year delivery, and include a range of lesson plans and worksheets, plus knowledge organisers and knowledge tests that retest previous learning, as well as testing understanding of what students have just studied.

Preparing KS3 students for studying the Pearson Edexcel GCSE (9–1) History qualification

HISTO

RYAG

ES 11–14

77

What was England like before the Battle of Hastings?

1515

What can we learn from archaeologists and historians about Anglo-Saxon England?Historians living in England before 1066 were usually monks. They were among the few people who could both read and write. They took a keen interest in what was happening around them and what had happened in the past. Monks o� en had a very fi rm point of view.

Invaders of Britain, 410–1042

440s: Saxon raids begin

793–95: Vikings raid Lindisfarne, Jarrow and Iona

597: Augustine’s Christian mission arrives in Kent

878: Alfred defeats the Vikings at Edington

410: Roman army leaves Britain

477–95: Saxons settle in Sussex and Wessex

620s: Sutton Hoo burial

871: Alfred becomes king of Wessex

865: Viking ‘Great Army’ arrives

Invaders of Britain, 410–1042

Timeline

Source A: Written by a monk, the Venerable Bede, in his Ecclesiastical History of the English People in 731. Here he is describing the arrival of the Saxons in around AD 440.

� ey came from three very powerful Germanic tribes, the Saxons, Angles and Jutes. From the Saxon country, that is, the district now known as Old Saxony, came the east Saxons, the South Saxons and the West Saxons. It was not long before such hordes of these alien people crowded into the island that the natives who had invited them began to live in terror. � ese heathen conquerors devastated the surrounding cities and countryside and established a stranglehold over nearly all the doomed island.

Source B: A necklace found in the grave of a Saxon woman. It is made from gold, glass and garnets, which are semi-precious stones. Archaeologists date it from around AD 600.

1 In which centuries did these events occur: a the Saxon raids beganb the Vikings raided Lindisfarnec Alfred became king of Wessex?

2 Work with a partner. Write down everything you can fi nd out from Source A about the Saxon invasions.

3 The author of Source A was a monk. Do you think this would have infl uenced the way he wrote about the invasions? Discuss this in your class. Try to reach a decision together.

4 Look carefully at Source B. What does it tell you about Anglo-Saxon society at that time? Write two or three sentences about this. For example, you might think about cra� skills or the importance in society of some women.

Your turn!

M01_ExpHistory1_SB_KS3_8694_U01.indd 15 07/08/2017 15:09


Free Interactive Scheme of Work

Our new, free Interactive Scheme of Work also helps you prepare your students for GCSE by recommending a teaching route through KS3 based on the options you select at GCSE – whether you teach KS3 over two or three years.

Designed to be tailored to your approach to teaching, this fantastic free online planning tool helps you manage the time needed to teach the content for history by recommending how long to spend on each unit. It also provides you with a guide for teaching the content, including suggested topics and an idea of when to teach skills.

Visit our website to access the free Interactive Scheme of Work.

NEW KS3 EXPLORING HISTORYTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

STUDENT RESOURCESExploring History Student Book 1: Monarchs, Monks and Migrants

978 1 292218 69 4

Exploring History Student Book 2: Cavaliers, Colonies, and Coal

978 1 292218 70 0

Exploring History Student Book 3: Trenches, Treaties and Terror

978 1 292218 71 7

TEACHER RESOURCESExploring History 2-year Teacher Resource Year 7

978 1 292227 14 6

Exploring History 2-year Teacher Resource Year 8

978 1 292227 15 3

Exploring History 3-year Teacher Resources Year 7

978 1 292227 16 0


978 1 292227 17 7


978 1 292227 18 4

1414

England before the Battle of Hastings was a land of huge forests, great open fi elds, villages and small towns. It had been part of the Roman Empire since AD 43, but in 410 the Roman army le� , along with most of the Roman people who had settled in Britain. Rome itself was being threatened by tribes from northern Europe and the army was needed to defend the city. The same tribes raided, invaded and settled in England, a country that the Romans had le� almost defenceless.

In 1042, England was fi nally peacefully united under one king: King Edward the Confessor. About 1.5 million people, mainly Anglo-Saxons*, lived in England and most of them worked on the land. It was a prosperous country, where agriculture and industry fl ourished. Governed by the king, who was advised by a council of powerful nobles, Anglo-Saxon England was generally peaceful. Most people understood and accepted their place in society: who they had to obey, and who had to obey them.

This section of the book will look at:

• the chronology of the history of England from 410 to 1066

• the ways in which people lived and were governed in Anglo-Saxon England from 1042 to 1066

• some of the ways that archaeologists and historians have found out about Anglo-Saxon England.

What was England like before theBattle of Hastings?

What do you think life in England was like before 1066?

What do you think?

Welcome to Anglo-Saxon England

• Know about the chronology of English history from 410 to 1066.

• Understand the importance of the work of archaeologists and historians in fi nding out about Anglo-Saxon England.

• Know about the chronology of English history from 410 to 1066.

Learning objectives

‘Look to your own defences.’ With these chilling words from their emperor in AD 410, the Roman army le� Britain. In the centuries that followed, Scots and Picts, Jutes and Vikings, Angles and Saxons raided and invaded Britain. Some stayed for a short time, some for longer, and some didn’t stay for any more time than it took to grab whatever their raiding parties could lay their hands on. Most of them fought each other. What sort of country, and what sort of people, emerged from these chaotic years?

We are going to look at some items from this period to see what we can learn from them about the people who made them and used them. But fi rst we need to get the raiders and invaders, and the important things they did, in the right order, which is shown in the Timeline opposite.

Anglo-Saxon*: The name ‘Anglo-Saxon’ comes from the Angles and the Saxons, two of the north European tribes that invaded and lived in Britain from the fi � h century onwards.

Anglo-Saxon*: The name

Key terms

M01_ExpHistory1_SB_KS3_8694_U01.indd 14 07/08/2017 15:09Sample from Exploring History Student Book 1: Monarchs, Monks and Migrants

The activities are carefully designed to progress students on the Pearson Progression Scale, which is linked to the GCSE mark schemes. Where possible, questions are assigned Steps so that you know the level of demand.

Open questions at the start of enquiries help you to gauge what your students might already know about a topic.

Where possible, features are identical to those in our GCSE textbooks, so students will already be familiar with these as they progress to GCSE.

Content is structured around engaging enquiry questions, chosen to cover important background material for GCSE units.

Timelines and questions focusing on chronology are included throughout the resources, helping to develop chronological understanding.

78

Edexcel International GCSE (9–1) History








l Reviewed by a language specialist to ensure the book is written in a clear and accessible style, and including a glossary of specialist subject vocabulary.

l Pearson Progression tools allow quick and easy formative assessment of student progress, linked to guidance on how to personalise learning solutions.



HISTO

RYAG

ES 14-16

79www.pearsonglobalschools.com/internationalGCSE



EDEXCEL INTERNATIONAL GCSE (9–1) HISTORYTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

A Divided Union: Civil Rights in the USA, 1945–74 Student Book and ActiveBook

978 0 435185 36 7

A Divided Union: Civil Rights in the USA, 1945–74 Online Teacher Resource Pack

978 0 435191 24 5

A World Divided: Superpower Relations, 1943–72 Student Book and ActiveBook

978 0 435185 44 2

A World Divided: Superpower Relations, 1943–72 Online Teacher Resource Pack

978 0 435191 31 3

Changes in Medicine, c1848–c1948 Student Book and ActiveBook

978 0 435185 40 4

Changes in Medicine, c1848–c1948 Online Teacher Resource Pack

978 0 435191 27 6

Conflict, Crisis and Change: China, 1900–1989 Student Book and ActiveBook

978 0 435185 37 4

Conflict, Crisis and Change: China, 1900–1989 Online Teacher Resource Pack

978 0 435191 23 8

Conflict, Crisis and Change: The Middle East, 1919–2012 Student Book and ActiveBook

978 0 435185 41 1

Conflict, Crisis and Change: The Middle East, 1919–2012 Online Teacher Resource Pack

978 0 435191 28 3

Development of Dictatorship: Germany 1918–45 Student Book and ActiveBook

978 0 435185 38 1

Development of Dictatorship: Germany 1918–45 Online Teacher Resource Pack

978 0 435191 25 2

Dictatorship and Conflict in the USSR, 1924–53 Student Book and ActiveBook

978 0 435185 46 6

Dictatorship and Conflict in the USSR, 1924–53 Online Teacher Resource Pack

978 0 435191 33 7

The Changing Role of International Organisations: the League and the UN, 1919–2011 Student Book and ActiveBook

978 0 435185 39 8

The Changing Role of International Organisations: the League and the UN, 1919–2011 Online Teacher Resource Pack

978 0 435191 26 9

The Origins and Course of the First World War, 1905–18 Student Book and ActiveBook

978 0 435185 42 8

The Origins and Course of the First World War, 1905–18 Online Teacher Resource Pack

978 0 435191 29 0

The Soviet Union in Revolution, 1905–24 Student Book and ActiveBook

978 0 435185 43 5

The Soviet Union in Revolution, 1905–24 Online Teacher Resource Pack

978 0 435191 30 6

The USA, 1918–41 Student Book and ActiveBook

978 0 435185 45 9

The USA, 1918–41 Online Teacher Resource Pack

978 0 435191 32 0

REVISION SUPPORTOur revise titles support all International GCSE and GCSE courses www.pearsonglobalschools.com/reviseGCSERevise GCSE Study Skills Guide 978 1 447967 07 1Revise GCSE Revision Planner 978 1 447967 82 8Revise GCSE Spelling, Punctuation and Grammar Revision Guide

978 1 292211 52 7


978 1 292211 49 7* Content for the Online Teacher Resource Packs will be delivered

via a phased release.

80

Edexcel GCSE (9–1) History

Our endorsed resources include 16 Student Books – one for every option in the Pearson Edexcel (9–1) History specification.

Every option is supported by our ActiveLearn Digital Service (available by annual subscription) offering front-of-class teaching, lesson plans, differentiation ideas, worksheets, exam question PowerPoints, assessments and teaching support.

Accessible text and structure, engaging images and sources and extension material help students of all abilities understand and enjoy the historical content.

Student Books, ActiveBooks (online eBook) and Kindle editions available for the following topics:

l Medicine Through Time, C1250-Present

l Crime and Punishment Through Time, C1000–Present

l Warfare Through Time, C1250–Present

l Anglo-Saxon and Norman England, C1060–1087

l The Reigns of King Richard I and King John, 1199–1217

l Early Elizabethan England, 1558–1588

l Henry Viii and His Ministers, 1509–1540

l Conflict in The Middle East, C1945–1995

l British America, 1713–1783: Empire and Revolution

l Spain and The ‘New World’, C1490–1555

l Superpower Relations and The Cold War, 1941–91

l The American West, C1836–C1895

l Mao’s China, 1945–1976

l Russia and The Soviet Union, 1924–1941

l The USA, 1954–1975: Conflict at Home and Abroad

l Weimar and Nazi Germany, 1918–1939

An integrated approach to developing confident, articulate and successful historians

Components for Edexcel GCSE (9–1) History:l Student Books x16 (Kindle editions also

available)

l ActiveBooks (online eBooks) x16

l ActiveLearn Digital Service Subscriptions

l Intervention Workbooks x9


Visit www.pearsonglobalschools.com/humanities for a full list of titles, ISBNs and prices.

12th


HISTO

RYAG

ES 14-16

81

Pearson Global Schools website


l Access to samples, free trials and demos to evaluate resources online

lFull component listings, along with downloadable structure charts and overview videos

lWrite your own product review and tell us what you think about our resources.

9:45 AM 100%iPad





82

Edexcel International GCSE (9–1) Geography

Is it for me?l Specifically developed for international learners, with

appropriate international content, making it engaging and relevant for all learners and allowing for learning in a local context, to a global standard.



l The accompanying Online Teacher Resource Pack (TRP) is an online, annual subscription containing material such as lesson plans, worksheets, fieldwork practicals, mock exam papers and presentations to support your planning and teaching and save you valuable time.



l Pearson Progression tools allow quick and easy formative assessment of student progress, linked to guidance on how to personalise learning solutions.




EDEXCEL INTERNATIONAL GCSE (9-1) GEOGRAPHYTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

Geography Student Book and ActiveBook

978 0 435184 83 4

Online Teacher Resource Pack Geography

978 0 435191 22 1


978 1 292211 52 7


978 1 292211 49 7

GEO

GRA

PHY

AGES 14–16

83

Edexcel GCSE (9–1) Geography A and B

Our endorsed resources for the new Pearson Edexcel GCSE (9–1) Geography specifications help your students tackle the more demanding content. Combining print and digital resources to help students reach their full potential and reach the higher expectations of the new assessments.

Supports the development of key skills your students need to become confident geographers, including literacy and numeracy. Underpinned by proven Pearson approaches and the Pearson Progression scale so you can be sure every student is making progress.

l Accessible and engaging content, providing differentiation throughout to support learners of all abilities.

l An integrated approach to fieldwork, providing in context guidance to support assessment.

l ActiveLearn Digital Service supports front-of-class teaching with lesson plans, differentiation ideas, worksheets, exam question PowerPoints, assessments and teaching support.

Supporting the development of confident, articulate, analytical geographers

Components for Edexcel GCSE (9–1) Geography A – Geographical Themes and Challenges:l Student Book (Kindle edition also

available)

l ActiveBook Institutional Subscriptions (online eBook)


l Intervention Workbooks x9

l KS4 Progression Service and Tests

B – Investigating Geographical issues:l Student Book (Kindle edition also available)

l ActiveBook Institutional Subscriptions (online eBook)


l Intervention Workbooks


Visit www.pearsonglobalschools.com/humanities for a full list of titles, ISBNs and prices.

12th

www.pearsonglobalschools.com/humanities


84

Edexcel International GCSE (9–1) Accounting, Business, Economics and ICT











AGES 14–19

85

BUSIN

ESS



Evaluate Pearson Global Schools resources onlineMany of our resources are available to sample online. Evaluate resources at your own pace, anytime and anywhere.

www.pearsonglobalschools.com/onlinesampling

9:45 AM 100%iPad

EDEXCEL INTERNATIONAL GCSE (9–1) ACCOUNTING, BUSINESS, ECONOMICS AND ICTTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact

Accounting Student Book and ActiveBook 978 0 435189 65 5Accounting Online Teacher Resource Pack 978 0 435191 20 7Business Student Book and ActiveBook 978 0 435188 63 4Business Online Teacher Resource Pack 978 0 435191 35 1Economics Student Book and ActiveBook 978 0 435188 64 1Economics Online Teacher Resource Pack 978 0 435191 34 4ICT Student Book Book and ActiveBook 978 0 435188 93 1ICT Online Teacher Resource Pack 978 0 435191 36 8


978 1 292211 52 7


978 1 292211 49 7

www.pearsonglobalschools.com/internationalGCSE


Is it for me?l Recognised by universities worldwide and fully comparable

to UK reformed GCE A levels.



l The embedded transferable skills, needed for progression to higher education and employment, are signposted so students understand what skills they are developing and therefore go on to use these skills more effectively in the future.


l Accompanying Online Teacher Resource Packs (TRP) contain material such as mock exam papers, mark schemes and model exam answers with commentary to support you in preparing students for their exams.

l Reviewed by a language specialist to ensure the book is written in a clear and accessible style.

What’s new?l These are brand new resources to support the updated

Pearson Edexcel International Advanced Level (IAL), for first teaching from September 2018.



86

Edexcel International A Level (IAL) Accounting, Business and Economics

NEW

AGES 16–18

87

BUSIN

ESS




HOW TO SAMPLEDownload free samples of the Student Books at www.pearsonglobalschools.com/IAL

If you like this you may also like...Edexcel International GCSE (9–1) in Business and Edexcel International GCSE (9–1) in Economics - see pages 84–85.

ECONOMICSEdexcel International Advanced Level (IAL)Economics Student Book and ActiveBook 1

978 1 292239 19 4

Edexcel International Advanced Level (IAL)Economics Student Book and ActiveBook 2

978 1 292239 18 7

Edexcel International Advanced Level (IAL)Economics Online Teacher Resource Pack 1

978 1 292239 24 8

Edexcel International Advanced Level (IAL)Economics Online Teacher Resource Pack 2^

978 1 292239 22 4

ACCOUNTING Edexcel International Advanced Level (IAL) Accounting Student Book and ActiveBook 1 Publishing June 2019

978 1 292274 61 4

EDEXCEL INTERNATIONAL A LEVEL (IAL) - BUSINESS, ECONOMICS AND INFORMATION TECHNOLOGYTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact. Orders for the Online Teacher Resource Packs need to be accompanied by a digital subscription order form which can be downloaded at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

BUSINESSEdexcel International Advanced Level (IAL)Business Student Book and ActiveBook 1

978 1 292239 17 0

Edexcel International Advanced Level (IAL)Business Student Book and ActiveBook 1

978 1 292239 16 3

Edexcel International Advanced Level (IAL)Business Online Teacher Resource Pack 1

978 1 292239 23 1

Edexcel International Advanced Level (IAL)Business Online Teacher Resource Pack 2*

978 1 292239 21 7

www.pearsonglobalschools.com/IAL

*Available June 2019^Available August 2019

Is it for me?l Written specifically for the new 2018 specifications.

Offering support to a qualification that is fully comparable to the reformed UK GCE A levels, and recognised as equal to the GCE by universities worldwide.

l Appropriate international content puts learning in a real-world context, to a global standard making it engaging and relevant for all learners. Language is reviewed by a specialist to ensure materials are written in a clear and accessible style.

l Support for Information Technology is provided entirely via the online Teacher Resource Pack provides you with access to a range of helpful materials via an annual subscription, including:

- Lesson plans and worksheets - Summative tests - Exam practice - Model answers

What’s new?l A brand new resource to support the updated

Pearson Edexcel International Advanced Level (IAL), for first teaching from September 2018.

Developed for the new International A Level specification, this new resource is specifically designed for international students, with a strong focus on progression, recognition and transferable skills, allowing learning in a local context to a global standard.

88

Edexcel International A Level (IAL) IT

NEW


EDEXCEL INTERNATIONAL A LEVEL (IAL) - INFORMATION TECHNOLOGYTo place an order contact your customer services team or local consultant www.pearsonglobalschools.com/contact. Orders for the Online Teacher Resource Packs need to be accompanied by a digital subscription order form which can be downloaded at www.pearsonglobalschools.com/orderform. Send this with your order via your usual ordering method.

INFORMATION TECHNOLOGYEdexcel International Information Technology Online Teacher Resource Pack

978 1292255 25 5

AGES 16–18

89

BUSIN

ESS

PEARSON EDEXCEL INTERNATIONAL AS / A LEVEL

GEOGRAPHYTEACHER RESOURCE PACK


TEACHER RESOURCE PACKS


ENGLISH LITERATURETEACHER RESOURCE PACK


FRENCHTEACHER RESOURCE PACK


GEOGRAPHYTEACHER RESOURCE PACK


HISTORY CHINA, 1900–76 TEACHER RESOURCE PACK


PSYCHOLOGYTEACHER RESOURCE PACK


SPANISHTEACHER RESOURCE PACK

For more information go to www.pearsonglobalschools.com/IAL

More support for you.A better experience for your students.

Online Teacher Resources Packs include curriculum-matched resources such as exam-style questions, practice exam papers and mark schemes.

Arabic | English LiteratureFrench | Geography | German

History | Law | Psychology | Spanish

Available June 2019

www.pearsonglobalschools.com/ial

90

International Baccalaureate©

Our comprehensive range of IB resources span PYP, MYP and DP to support your students in their IB learning journey.

Written by expert authors who know how to teach the IB, and developed to meet the exact requirements of the IB specifications, you can be sure our resources will provide everything you need and more!

All of our Diploma resources are available as a printed textbook with an eText, or as a standalone eText.

We are continuing to develop our range of IB Diploma resources in line with the latest curriculum changes. We pride ourselves on working with teachers to ensure we provide you with what you need to support your IB students’ learning journey.

Learn more at www.pearsonglobalschools.com/ibSee pages 94-101

We offer engaging resources that promote 21st century learning by connecting academic content with real life. International Mathematics for MYP remains one of our best-selling titles for IB schools.

Learn more at www.pearsonglobalschools.com/ibSee pages 92-93

Inquiry-based teaching means being flexible and finding content that keeps your learners engaged and motivated. Our PYP resources can help you find the right content for all your lessons.

See our 2019 Primary/Elementary Catalogue for details of our resources or learn more at www.pearsonglobalschools.com/ib

D P

MYP

PYP

INTERN

ATIO

NA

L BACCA

LAU

REATE

AGES 11–16

91

*Ok, the jetpack bit isn’t true, but we know that pointless gadgets aren’t really what you need to teach the IB curriculum. What you need is a clear, effective and well-signposted toolkit. So, we’ve made sure all our resources are well-researched, clearly-laid out and full of simple, practical ideas.

The stuff you need without the clutter you don’t.And no jetpack shoes. Sorry.

• 25 subjects covered• 148 expertly-written

textbooks• 4,000+ interactive

learning activities• A pair of shoes

with built-in jetpacks*

Find out more at www.pearsonglobalschools.com/ib

C

M

Y

CM

MY

CY

CMY

K

Pearson IB Advert (Full page).pdf 1 27/07/2018 12:20

www.pearsonglobalschools.com/ib

Our best-selling five-book series is tailored for students studying MYP. All examples and exercises take an international viewpoint, giving students an opportunity to learn Mathematics with a global perspective.

All content has now been mapped to the 2014 MYP Mathematics Guide. With 98% of topics and 91% of skills from the framework covered. Download the mapping document www.pearsongllobalschools.com/ib

92

MAPPED TO THE 2014 GUIDEMiddle Years Maths

Investigations encourage learners to seek knowledge and develop research skills.

Links to foundation and challenge worksheets provide alternative exercises for consolidation or extension.

Worked examples show learners how to approach questions.

Levels of difficulty are indicated by colour.

MYP

AGES 11–16

93

Middle Years Science

www.pearsonglobalschools.com/ib - Sign up for a demo and to find out more.

Try our flexible digital course pilot for MYP Science. Structured by topic and consisting of animations, interactive activities, presentations, videos and auto-marked exercises, our engaging content gives you the freedom to teach your school’s MYP curriculum.


INTERNATIONAL MATHEMATICS FOR THE MIDDLE YEARSEvaluate this series with free online samples at www.pearsonglobalschools.com/onlinesampling. To place an order, contact your customer services team or local consultant www.pearsonglobalschools.com/contact

International Mathematics 1 Course book

978 0 733985 02 7

International Mathematics 1 Teacher resource

978 0 733985 04 1


978 0 733983 88 7


978 0 733985 06 5


978 0 733985 22 5


978 0 733985 24 9


978 0 733985 19 5


978 0 733985 21 8


978 0 733985 91 1


978 0 733985 93 5

NEW

94

Is it for me?l A suite of textbooks, eTexts and online resources supports

teachers and students at every level – in the classroom, during independent study and for revision.

l Clear links to TOK throughout the books, as well as advice on the Internal Assessment and the latest requirements for the Extended Essay.

l Packed full of exam-style assessment opportunities using questions from past papers, as well as guidance from subject experts and examiners.

l Written by experienced IB teachers, workshop leaders and examiners, meaning you can rest assured that the need-to know content will be covered properly and clearly.

l A great solution for a wider range of teaching and learning contexts.

Our IB Diploma resources provide all you need to teach and study the IB Diploma curricula, offering textbooks, eBooks and online support materials. Each book covers the Subject Guide fully, for the most up-to-date support.

for the Pearson International Diploma

International Baccalaureate©

Pearson materials are developed independently from the IBO and are not endorsed by the IBO in any way. International Baccalaureate® is a registered trademark of the International Baccalaureate Organization.

Sample our eTexts Access samples of our enhanced eTexts and see for yourself how they bring learning to life - with animations, videos, worksheets, quizzes and much more! www.pearsonglobalschools.com/ib

DIPLO

MA

AGES 16–18

95

Pearson Baccalaureate Series

Group 1 Studies in Language and Literature

Group 2 Language Acquisition

Group 3 Individuals and Societies

Group 4 Sciences

Group 5 Mathematics

Core Curriculum

All of our IB Diploma titles are available

as a printed textbook with a free eText, or as

a standalone eText.

Also available: Essentials series

See page 98


PE

AR

SO

N

BA

CC

AL

AU

RE

ATE

HIGHER LEVEL

S TANDARD LEVEL

HIGHER LEVEL

S TANDARD LEVEL

HL

SL

www.pearsonbaccalaureate.com

English: ALiterature

Sup

po

rting every learn

er across th

e IB co

ntin

uu

mP

EA

RS

ON

BA

CC

AL

AU

RE

AT

E

P E A R SO N B ACC A L AU R E AT E

LiteratureEnglish: ASupporting every learner across the IB continuum

JAN ADKINS • CONRAD HUGHES

English: ASupporting every learner across the IB continuum


Literature Pearson Baccalaureate English A: Literature is an exciting textbook for students and teachers of the International Baccalaureate Diploma, written and developed by practising IB teachers. Suitable for both Standard and Higher Level studies, it covers all the elements of the curriculum in depth, along with advice on the Extended Essay and links to Theory of Knowledge. It will help you to prepare thoroughly and methodically for your examinations.

• Provides comprehensive coverage of all the requirements for the 2011 curriculum

• Addresses each of the four parts of the curriculum, and contains extensive modelling exercises for students

• Gives clear links to TOK throughout • Enables exam-style assessment opportunities using questions

from past papers • Supports each of the assessments and provides guidance on

the Extended Essay • Features integrated online learning resources at

www.pearsonbacconline.com to support and extend study.

There are many more titles in the Pearson Baccalaureate series. Visit www.pearsonbaccalaureate.com for a complete list.

Jan Adkins has been teaching IB English at St Petersburg High School in Florida for over 20 years. She has also worked as an IB North America workshop presenter, and as a consultant for IBM, producing various instructional products for IBM Education in Atlanta and Thornwood, New York. She is the recipient of the Robert O. Lawton Award for Teaching Excellence at Florida State University and the Teaching Excellence Award at Eckerd College. Jan holds a PhD in English.

Conrad Hughes teaches English and ToK at the International School of Geneva (Campus des Nations) where he coordinates the Diploma Programme. He leads workshops for the IB on English and DP coordination and has taught in France, India, and Switzerland for more than ten years. He holds a PhD in English literature.

DE

VE

LOP

ED

SP

EC

IFICA

LLY FOR

THE

IB D

IPL

OM

A

CVR_ENGL_SB_IBD_2623_CVR.indd 1 19/10/2015 15:07


2nd EditionKnowledgeTheory of

Supporting every learner across the IB continuum

SUE BASTIAN • JULIAN KITCHING • RIC SIMS

KnowledgeTheory of


2nd Edition


Combined with enhanced online eBook access, Pearson Baccalaureate Theory of Knowledge 2nd Edition is a complete offering for the IB Diploma. Written by experienced IB practitioners, it covers everything you need to study for the latest Theory of Knowledge syllabus and will also help you to prepare thoroughly for your Prescribed Essay and Student Presentation.

● Provides comprehensive coverage of the new Knowledge Framework and additional Areas of Knowledge.

● Engages students in critical thinking relevant to their other courses and their life outside the classroom.

● Enables clear links to the Learner Profi le, the IB core values and all the IB curriculum framework areas.

● Offers assessment opportunities using questions from past Prescribed Essays.

● Provides guidance on the Prescribed Essay and Student Presentation.

The Pearson Baccalaureate series includes many more titles, across the entire IB continuum. Visit www.pearsonbaccalaureate.com for a complete list.

Sue Bastian has been involved with the IB for three decades. She began teaching ToK, Psychology, and Philosophy in the Philippines in 1974, before moving to the United Nations International School in New York City in 1980. Sue has been a Deputy Chief Examiner and Chief Examiner and is currently a consultant and workshop leader.

Julian Kitching has taught IB Biology since 1988 and Theory of Knowledge since 1990. He helped to set up the SOS Hermann Gemeiner International College in Ghana – a school mainly funded by the charitable organization SOS Kinderdorf and the fi rst IB diploma programme school in West Africa. Julian has been a member of the senior management team there since 1999. In the 1990s, Julian assisted in the creation of the current overall structure of the ToK programme. He has been an examiner since 1996 and assumed the role of Chief Assessor in September 2010. Since 1995, he has led or co-led twenty workshops.

Ric Sims has taught ToK for nearly 20 years in a number of European schools in combination with Maths, Music, Philosophy, and Economics. He has been involved in ToK curriculum development since 1997, including the 2013 curriculum review, and was Deputy Chief Assessor 2000–2005. He is interested in teacher training in ToK and has led more than 50 workshops over the last ten years. He is an examiner for Economics and Music and teaches at Katedralskolan in Uppsala Sweden.


Theory of K

nowledge

2nd Edition

Sup

po

rting every learn

er across th

e IB co

ntin

uu

mP

EA

RS

ON

BA

CC

AL

AU

RE

AT

E

CVR_TOK_SB_IBD_4157_CVR.indd 1 09/07/2013 17:03

interactive

Mathematics Analysis and Approaches

IBRAHIM WAZIRTIM GARRY

For the IB Diploma

STANDARD LEVEL

interactive



For the IB Diploma

HIGHER LEVEL STANDARD LEVEL

interactive

Mathematics Applications and Interpretation

TIM GARRYIBRAHIM WAZIR

KEVIN FREDERICKBRYAN LANDMANN

For the IB Diploma

availableP E A R SO N B ACC A L AU R E AT E

PsychologyCHRISTIAN BRYAN • PETER GIDDENS • CHRISTOS HALKIOPOULOS

Suppor ting every learner across the IB continuum


H I S T O R Y P A P E R 3

The Cold War and the

Americas (1945–1981)

EUNICE PRICE • KEELY ROGERS • DANIELA SENÉS

Suppor ting every learner across the IB continuum

HIGHER LEVEL

interactive


TIM GARRYIBRAHIM WAZIRJIM NAKAMOTO

KEVIN FREDERICKSTEPHEN LUMB

For the IB Diploma

New Français B

COMING SOON

New Español B

COMING SOON

New English B

COMING SOON

With integrated online learning resources!

Visit www.pearsonbacconline.com

NM/SLNS/HL

P E A R S O N BACCALAUREATE

Français BLivre de professeur

AMÉLIE NADEAU

NEW

96

How does it work?

Teaching, Learning and Assessment with our printed and digital resources

Sample spread from Pearson Baccalaureate Biology 2nd Edition

Sample spread from Pearson Baccalaureate The Cold War: Superpower tensions and rivalries 2nd Edition

Student material is available as a printed book with free access to an online eText which can be viewed on a computer, whiteboard or tablets.

Pearson Baccalaureate Biology 2nd Edition eText animation - just one of the many additional resources offered

Assessment tools and resources are aligned to the programme criteria and learning objectives. This means that learners know the areas they need to improve on and are offered plenty of practice along their learning journey.

necessity’. Khrushchev then cancelled Eisenhower’s planned visit to the Soviet Union and the meeting broke up with no further progress being made on a settlement for Berlin or a test-ban treaty. By 1962, any ‘thaw’ that might have been achieved was shown to be quite definitely at an end when the USA and the USSR had their most intense and dangerous conflict yet, over Cuba (see chapter 9).

Activity 6 Self-management skillsATL

1. What issues/events prevented any lasting Cold War ‘thaw’ during this period?

2. Explain the meaning of the following: co-existence, massive retaliation, New Look.

3. Who or what was each of the following, and how did each one affect East–West relations during the 1950s?

a. the Suez Crisis

b. the Eisenhower Doctrine

c. the Hungarian Uprising

d. the Geneva Summit

e. Sputnik

f. the Gaither Report

g. the U-2 incident

NB for some of these, you may need to do extra research. See also chapters 13 and 18.

Activity 7

Structuring the main body of an essay Communication skillsATL

Here again is an essay question posed at the beginning of this chapter:

To what extent was there a thaw in the Cold War between 1953 and 1960?

Introduction: Look back at the work you did on introductions in the previous chapter and at the guidelines in chapter 3. What would be your starting point with the introduction for this essay?

Main body of the essay: As explained in the essay flow chart in chapter 3, you need to have a clear opening sentence to start each paragraph. This sentence must make it obvious what the point of the paragraph is going to be, and it must clearly link back to the question. The rest of the paragraph should then provide evidence to support your opening statement.

1. Look at the statements below. They can be grouped into three paragraphs to form the main body of the essay. Decide which statements fit better as: a) opening statements for one of the paragraphs of this essay; b) evidence in the main body of the paragraphs.

● The war in Korea was brought to a close. ● There were positive steps towards a reduction of tension and thus a ‘thaw’ after 1953. The USA continued to see the USSR as a threat in such areas as Asia.

● Tension increased dramatically in the late 1950s due to a series of incidents, which makes it clear that there was in fact no fundamental change in the relationship between the superpowers.

● Austria was finally unified. ● The shooting down of the U-2 spy plane ended any good relations that had been built up during Khrushchev’s visit to the United States.

● Nothing concrete was achieved at the Geneva Summit regarding the arms race or the German question. ● There is much evidence that there was still tension between the USA and the USSR after 1953. ● Sputnik raised new fears of superior Soviet technology and of a ‘missile gap’. Khrushchev raised tensions over Berlin with an ultimatum to the West to leave.

● There was co-operation in cultural and economic areas following the ‘spirit of Geneva’. Cuba brought the Soviet Union and the United States close to a direct nuclear confrontation.

2. In which order would you place the paragraphs? What other evidence might you add in each paragraph?

3. Write a conclusion that supports the arguments that are in the main body of the essay.

NB make sure you have made notes on the role of Khrushchev from this chapter. In chapter 9, we will analyse his policy of ‘peaceful co-existence’ more fully and develop essay questions on this theme.

99

Peaceful co-existence: New leaders, new ideas? 07

To access websites relevant to this chapter, go to www.pearsonhotlinks.com, search for the book title or ISBN, and click on ‘chapter 7’.

M07_HICW_SB_IBGLB_2364_U07.indd 99 10/06/2015 10:34

Activity 5 Thinking skillsATL

1. Why do you think the cartoonist has shown both leaders crossing their fingers? What is the message of this source?

The U-2 incidentAgain, although the meeting between Eisenhower and Khrushchev in the United States produced few concrete results, the talks were a success in terms of generating a positive atmosphere, which led people to talk of the ‘spirit of Camp David’ (Eisenhower’s presidential retreat in Maryland). This optimism was short-lived, however, as a few days before the summit meeting convened in Paris, the Soviets announced that an American plane had been shot down over the Soviet Union on 1 May 1960. The Americans tried to claim it was only a weather plane, which had gone o� course, but the Soviets were able to reveal that the aircraft was a high-altitude photo-reconnaissance plane. Even more damaging, the pilot, Gary Powers, who had been captured, confessed to the ‘spy’ nature of his task. Eisenhower then admitted the truth about the U-2 spy planes and took personal responsibility for the incident.

However, at the Paris Summit, Eisenhower refused to apologize for the U-2 incident or to condemn U-2 flights, saying that aerial surveillance was ‘a distasteful, but vital

98

Part 1 Rivalry, mistrust and accord

This Herblock cartoon shows Eisenhower and Khrushchev

together in 1959 in the United States.

M07_HICW_SB_IBGLB_2364_U07.indd 98 10/06/2015 10:34

DIPLO

MA

AGES 16–18

97

Enhanced eTextsOnline eTexts offer all the great things about the printed textbook plus a host of additional interactive content.

l Access content anywhere and anytime - perfect for home learning and learning on the move.

l Digital note-taking, sharing, highlighting and bookmarking make study and revision more effective.

l Search for key terms to speed up learning.

l Downloadable files for offline use.

l Self-marking quizzes, worksheets, animations and posters.

Access all your eBooks from your bookshelf

Find digital resources, like videos, animations, quizzes, worksheetsand more by selecting the “Resources” icon

Bookmark pages for quick navigation

Glossary of key terms to provide language support

Download chaptersfor offline use

Search and jump to pages containing specific words

Turn pages by swiping or using side butons

Highlight key words and phrases

The Essentials series is designed for revision and provides a condensed and practical exam preparation guide. Students can get help on what is expected in the exam: model sentences, answer-openers, suggestions for case studies and general exam advice.

Sample page from Essentials: Global Politics

1137 Exam support

Paper 1 (stimulus-based paper) technique

Paper 1 basicsBoth Higher Level and Standard Level students sit the same paper which lasts 1 hour 15 minutes. This paper is a stimulus-based paper on a topic taken from one of the four core units. Four stimuli are presented, which may be written, pictorial or diagrammatic, and which link to one of the four core units. Students must answer all four structured questions.

The maximum mark for this paper is 25. The paper is marked using a paper-specifi c analytic markscheme and for the fourth question, markbands are additionally used (see below).

Each question tests different assessment objectives. READ THE QUESTIONS FIRST – then you can read the sources knowing what you are looking for.

Question format and advice

Assessment objective Relevant command terms (see page x)

1. Tests understanding of a source

You will be asked to extract information given to you in a source, which might be text, an image, or in the form of statistics. You must put it into your own words, showing that you have understood it. Five lines or so is probably about right. If you are asked to explain information from a source, take care not to simply copy the information word for word.

Top tipAim to get through this question quickly – take no more than 5 minutes.

Assessment objective 1: Knowledge and understanding

• Demonstrate knowledge and understanding of key political concepts and contemporary issues in global politics.

• Demonstrate understanding of relevant source material.

• Demonstrate understanding of a political issue in a particular experiential situation (engagement activity).

Describe Give a detailed account.

Defi ne Give the precise meaning of a word, phrase, concept or physical quantity.

Identify Provide an answer from a number of possibilities.

Outline Give a brief account or summary.

7 Exam support

Synonyms

contemporary present

M07_ESGP_SB_IBDGLB_9263_C07.indd 113 10/06/2016 11:00

‘I can see using this eText to illustrate study techniques/note taking the PDF files of chapters would allow students to tailor study notes for themselves. ... the eText/PDF files would allow projection of text and diagrams for discussion and illustration.’


98

Pearson Baccalaureate Essentials seriesDesigned to supplement our core textbooks, acting as a condensed guide to Diploma subjects.

The books are written in a clear style with efficient, succinct sentences which are perfect for revision and accessible for students whose first language is not English. They contain:

l focused content structured around the learning objectives of each Subject Guide

l model sentences to guide responses, answer-openers and exam advice

l synonym, glossary and subject vocabulary boxes

l Extended Essay and Internal Assessment proposals and support

l highlighted key words and phrases, placed within the context of the course.

Chemistry

essentials

ChemistryP E A R SO N B ACC A L AU R E AT E


esse

ntia

ls

CATRIN BROWN • GARTH IRWINSERIES EDIOR: CHRISTIAN BRYAN


S u p p o r t i n g e v e r y l e a r n e r a c r o s s t h e I B c o n t i n u u m


PE

AR

SO

N B

AC

CA

LA

UR

EA

TE

Essentials C

hemistry

Pearson Baccalaureate Essentials is the fi rst IB series written specifi cally for EAL students. Designed to supplement standard textbooks, each book acts as a condensed guide to Diploma subjects, with targeted language to embed key concepts without the obstacle of translation. The books are written in a clear academic style – effi cient, succinct sentences which are accessible for students whose fi rst language is not English.

The series contains: ● focused content structured around the learning objectives of each subject guide

● model sentences to guide responses, answer-openers and exam advice

● synonym, general vocabulary and subject vocabulary boxes

● extended essay and internal assessment proposals and support

● highlighted key words and phrases, placed within the context of the course

● accompanying eBook with audio fi les of glossaries and model sentences, plus PDFs of complete vocabulary lists.

Pearson Baccalaureate Essentials can also be used by non-EAL students as clear and targeted revision guides.

HIGHER LEVEL

S TANDARD LEVEL

HLSL

HIGHER LEVEL

S TANDARD LEVEL

CVR_ESCH_SB_IBD_4536_CVR.indd 1 22/09/2015 10:39

ELL students struggle for a myriad of reasons – effort being foremost among them. The entire IB curriculum assumes a certain level of reading comprehension and willingness to invest time into the mastery of outcomes presented. Pearson Essentials would be a good option for these students as they are shown what the basic expectation is allowing them to economize their efforts. Students also struggle to order and sequence information - the structure/format of the text therefore is advantageous.

Review from IB Coordinator, Citadel High School, Halifax, Nova Scotia:

PERFECT FOR

REVISION

DIPLO

MA

AGES 16–18

99www.pearsonglobalschools.com/ib

Global PoliticsThis textbook and eText for Global Politics from our Essentials series, contains comprehensive concept-based coverage of the Subject Guide.

Focusing on the overarching concepts, such as power, development and peace, it also supports students with key terminology and language, plus theoretical underpinnings and helps with exam skills (essay writing and presentations in particular).

The Essentials format and focus on vocabulary makes it perfect for EAL learners too. Plus, its clear structure is great for revision.

Provides:

l comprehensive concept-based coverage

l up-to-date and relevant case studies and examples that allow students to develop an understanding of the local, national, international and global dimensions of political activity

l a focus on preparing students for their Internal and External Assessments

l clear accessible language, with vocabulary and audio support – perfect for EALs

l engagement activity, global political challenges and Extended Essay sections offer helpful input and guidance.

Review from a Global Politics teacher at at the Canadian International School of Beijing:

It takes all of the essentials from the IB Subject Guide and presents them in a way that is useful and concise … I would definitely use the book and would recommend it to other GloPo teachers. I think this is what we as teachers have been waiting for and GloPo will be be offered in more schools once this book is available and teachers become aware of it.

About the Author, Robert MurphyRobert has been Head of Global Politics at Wellington College since 2013. Before that he was a British diplomat working for the Foreign and Commonwealth Office in postings to Trinidad & Tobago, Bolivia, Venezuela, Pakistan and Somalia. Between 2009 and 2011 he was Head of Strategic Communications and Spokesman at the British High Commission, Islamabad, running communications projects from counter-radicalisation to development. In 2012/13, he spent a year living and working in Somalia advising the African Union Peacekeeping Mission to Somalia on their strategic communications programmes.

100

PEARSON BACCALAUREATE IB DIPLOMA To place an order, contact your customer services team or local consultant www.pearsonglobalschools.com/contact.

THEORY OF KNOWLEDGETheory of Knowledge, 2nd edition (print and eText)

978 1 447944 15 7

Theory of Knowledge, 2nd edition (eText only edition)

978 1 447944 14 0

SCIENCESBIOLOGYBiology Standard Level 2nd Edition (print and eText)

978 1 447959 04 5

Biology Standard Level 2nd Edition (eText only edition)

978 1 447959 05 2

Biology Higher Level 2nd Edition (print and eText)

978 1 447959 00 7

Biology Higher Level 2nd Edition (eText only edition)

978 1 447959 01 4

PHYSICSPhysics Standard Level 2nd Edition (print and eText)

978 1 447959 08 3

Physics Standard Level 2nd Edition (eText only edition)

978 1 447959 09 0

Physics Higher Level 2nd Edition (print and eText)

978 1 447959 02 1

Physics Higher Level 2nd Edition (eText only edition)

978 1 447959 03 8

CHEMISTRYChemistry Standard Level 2nd Edition (print and eText)

978 1 447959 06 9

Chemistry Standard Level 2nd Edition (eText only edition)

978 1 447959 07 6

Chemistry Higher Level 2nd Edition (print and eText)

978 1 447959 75 5

Chemistry Higher Level 2nd Edition (eBook only edition)

978 1 447959 76 2

MATHEMATICSMATHEMATICS ANALYSIS AND APPROACHESStandard Level Text and eBook 978 1292267 41 8Standard Level eBook 978 1292267 40 1 Higher Level Text and eBook 978 0 435193 42 3Higher Level eBook 978 0 435193 43 0MATHEMATICS APPLICATIONS AND INTERPRETATIONStandard Level Text and eBook 978 0 435193 45 4Standard Level eBook 978 0 435193 41 6Higher Level Text and eBook 978 0 435193 44 7Higher Level eBook 978 0 435193 40 9

HISTORYThe Cold War: Superpower tensions and rivalries 2nd Edition (print and eText)

978 1 447982 36 4

The Cold War: Superpower tensions and rivalries 2nd Edition (eText only)

978 1 447982 37 1

Causes and Effects of 20th Century Wars 2nd Edition (print and eText)

978 1 447984 15 3

Causes and Effects of 20th Century Wars 2nd Edition (eText only)

978 1 447984 16 0

Authoritarian States 2nd Edition (print and eText)

978 1 292102 57 3

Authoritarian States 2nd Edition (eText only) 978 1 292102 58 0

The Move to Global War (print and eText) 978 1 292102 59 7

The Move to Global War (eText only) 978 1 292102 60 3

History Paper 3: European States in the Inter-War Years (1918-1939) (print and eText)

978 0 435183 15 8

History Paper 3: European States in the Inter-War Years (1918-1939) (eText only)

978 0 435183 14 1

History Paper 3: The Cold War and the Americas (1945-1981) (print and eText

978 0 435183 12 7

History Paper 3: The Cold War and the Americas (1945-1981) (eText only)

978 0 435183 13 4

ENVIRONMENTAL SYSTEMS AND SOCIETIESEnvironmental Systems and Societies 2nd Edition (print and eText)

978 1 447990 42 0

Environmental Systems and Societies 2nd Edition (eText only)

978 1 447990 43 7

PSYCHOLOGYPsychology (eText only edition) 978 0 435189 63 1 Psychology (print and eText) 978 1 292210 99 5

ECONOMICSEconomics (eText only edition) 978 1 447938 49 1Economics (print and eText) 978 1 447990 67 3

LANGUAGESENGLISH AEnglish A: Literature (eText only edition) 978 1 447952 23 7English A (print and eText) 978 1 447960 48 5ENGLISH BEnglish B (print and eText) 978 1 447944 13 3English B (eText only edition) 978 1 447944 17 1LANGUAGES - FRANÇAIS BFrançais B Student Book (print and eText) 978 1 447980 59 9Français B Student Book (eText only edition) 978 1 447952 25 1Français B Teacher Book 978 0 435074 54 8LANGUAGES - ESPAÑOL BEspañol B Student Book (print and eText) 978 1 447990 66 6Español B Student Book (eText only editon) 978 1 447952 24 4Español B Teacher Book 978 0 435074 52 4

IB DIPLOMA ESSENTIALS SERIESEssentials: Psychology (print and eText) 978 1 447951 52 0Essentials: Psychology (eText only edition) 978 1 447951 53 7Essentials: Economics (print and eText) 978 1 447950 37 0Essentials: Economics (eText only edition) 978 1 447950 38 7Essentials: Environmental Systems and Societies (print and eText)

978 1 447950 34 9

Essentials: Environmental Systems and Societies (eText only edition)

978 1 447950 35 6

Essentials: Biology (print and eText) 978 1 447990 68 0Essentials: Biology (eText only edition) 978 1 447990 69 7Essentials: Theory of Knowledge (print and eText)

978 1 447990 70 3

Essentials: Theory of Knowledge (eText only edition)

978 1 447990 71 0

Essentials: Global Politics (print and eText) 978 1 447999 26 3Essentials: Global Politics (eText only edition)

978 1 447999 27 0

Essentials: Chemistry (print and eText) 978 1 292134 53 6

Essentials: Chemistry (eText only edition) 978 1 292134 54 3

DIPLO

MA

AGES 16–18

101

2018

2019

2020FIRST TEACHING

2021

2022

2023

International Baccalaureate (c) Diploma ProgrammeROADMAP FOR DIPLOMA CURRICULUM CHANGE

LANGUAGE B

LANGUAGE A

FRENCH SPANISH ENGLISH

LITERATURELANGUAGE AND LITERATURE

Workb�k - tbcWorkb�k - tbc

New edition

New edition - Su�er ‘19

SL

April-June '19HL SL HL

ANALYSIS AND APPROACHES

MATHS

APPLICATIONS AND INTERPRETATION

New edition New edition

TOK

ECONOMICS

MUSIC

CLASSICAL LANGUAGES

BUSINESS MANAGEMENT

BIOLOGY

CHEMISTRY

PHYSICS

COMPUTER SCIENCE

ITGS

LITERATURE AND PERFORMANCE

New SL and HL editions New SL and HL editionsNew SL and HL editions

PHILOSOPHY

DESIGN TECHNOLOGY

ESS

VISUAL ARTS

New edition New edition

New edition

GEOGRAPHY

GLOBAL POLITICS

WORLD RELIGIONS

This handy guide highlights when the International Baccalaureate (c) will be changing the curriculum guides for each subject, in line with their seven year cycle. For those subjects where we have already decided on what we will be publishing for we have marked that down for you too.


l All syllabus content clearly and thoroughly explained, including prior knowledge reminders.

l Additional integrated digital GeoGebra applets created specifically for the course.

l Plentiful worked examples to help students tackle questions.

l Practice exam-style questions to help students prepare.

l Rich and wide-ranging chapter TOK chapter.

l Guidance on the Internal Assessment.

Developed for first teaching in 2019 to fully support the extensive changes in the 2019 guide. These resources have been written by expert author team, Ibrahim Wazir, Tim Garry, Jim Nakamoto, Kevin Frederick, Bryan Landman and Stephen Lumb.

102

Mathematics

Our new IB resources

interactive



For the IB Diploma

STANDARD LEVEL

interactive



For the IB Diploma

HIGHER LEVEL

STANDARD LEVEL

interactive


TIM GARRYIBRAHIM WAZIR

KEVIN FREDERICKBRYAN LANDMANN

For the IB Diploma

HIGHER LEVEL

interactive


TIM GARRYIBRAHIM WAZIRJIM NAKAMOTO

KEVIN FREDERICKSTEPHEN LUMB

For the IB Diploma

Figure 6.6 shows all of the angles between 0° and 360° inclusive that are multiples of 30° or 45°, and their equivalent radian measure. You will benefit by being able to convert quickly between degree measure and radian measure for these common angles.

Because 2p is approximately 6.28 (3 s.f.), there are a little more than six radius lengths in one revolution, as shown in Figure 6.5.

6 radians

5 radians4 radians

3 radians

2 radians 1 radian

r

r

r

r

r

r

x

y90°

270°

180°0

360°

330°

315°240°

225°

210°

150°

135°120°

300°

60°45°

30°

π2 π

3π4

π6

π

2 π33 π

45 π6

7 π6

5 π4 4 π

35 π3

7 π4

02 π

11 π6

3 π2

For any angle u, its radian measure is given by u 5 s _ r . Simple rearrangement of this formula leads to another formula for computing arc length.

A circle has a radius of 10 cm. Find the length of the arc of the circle subtended by a central angle of 150°.

Solution:

To use the formula s 5 ru, we must first convert 150° to radian measure.

150° 5 150° ( p ____ 180° ) 5 150p _____ 180 5 5p ___ 6

Substituting r = 10 cm into s 5 ru gives

s 5 10 ( 5p ___ 6 ) 5 25p ____ 3 < 26.179 94 cm

The length of the arc is 26.2 cm (3 s.f.).

Example 6.3

150°

r � 10

s

(b) (i) 135° 5 3(45°) 5 3 ( p __ 4 ) 5 3p ___ 4

(ii) −150° 5 −5(30°) 5 −5 ( p __ 6 ) 5 − 5p ___ 6

(iii) 175° ( p ____ 180° ) < 3.0543 < 3.05 (3 s.f.)

(iv) 10° ( p ____ 180° ) < 0.174 53 < 0.175 (3 s.f.)

°

7

Trigonometric functions and equations6

Figure 6.5 Arcs with lengths equal to the

radius placed along the circumference of a circle.

Figure 6.6 Degree and radian measure for

common angles.

Arc length

For a circle of radius r, a central angle u subtends

an arc of the circle of length s given by

s = ru where u is in radian measure.

The units of the product ru are equal to the units

of r because in radian measure u has no units.

The diagram shows a circle of centre O with radius r 5 6 cm. Angle AOB subtends the minor arc AB such that the length of the arc is 10 cm. Find the measure of angle AOB in degrees, accurate to 3 significant figures.

_____________________________

Solution:

Rearrange the arc length formula, s 5 ru, giving u 5 s _ r . Remember that the result for u will be in radians. Therefore, angle AOB 5 10 ___ 6 5 5 __ 3 or 1.6 radians. Now, we convert

to degrees: 5 __ 3 ( 180° ____ p ) < 95.492 97°. The degree

measure of angle AOB is approximately 95.5°.

Example 6.4

6

10

A

O

B

segment

circumscribed circleof a polygon

inscribed circle of a polygon – the radius is perpendicular to the side of the polygon at the point of tangency

chord

radius

sector

centre

centralangle

r

arc

A sector of a circle is the region bounded by an arc of the circle and the two sides of a central angle (Figure 6.7). The ratio of the area of a sector to the area of the circle (pr 2) is equal to the ratio of the length of the subtended arc to the circumference of the circle (2pr ). If s is the arc length and A is the area of the sector, we can write the following proportion:

A ____ pr 2 5 s ____ 2pr

Solving for A gives:

A 5 pr 2s ____ 2pr 5 1 __ 2 rs.

From the formula for arc length we have s 5 r u, with u the radian measure of the central angle. Substituting r u for s gives the area of a sector to be A 5 1 __ 2 rs 5 1 __ 2 r(r u) 5 1 __ 2 r 2u.

.

8

Geometry of a circle

Figure 6.7 Circle terminology

Area of a sector In a circle of radius r, the area of a sector with a central angle u measured

in radians is A = r2u.

Sector of a circle

21

The formula for arc length, s = r u, and the formula for area of a sector, A = r 2u,

are true only when u is in radians.

21

NEWFOR 2019

DIPLO

MA

AGES 16–18

103

l Structured by prescribed theme to provide in-depth coverage of the new syllabus.

l Contains a wealth of topical and authentic texts accompanied by a broad range of questions and exercises.

l Links to TOK throughout.

l Audio files and exercises to help students prepare for the listening assessment.

l Suitable for SL and HL learners.

Written by two highly experienced authors and examiners, the new edition of this popular title will fully support the new Subject Guide, including coverage of the listening assessment.


English B

We are producing new French and Spanish resources for the new Language B guide.

To be the first to find out more visit www.pearsonglobalschools.com/ib and sign up to our IB newsletter.

Language B - French and Spanish

104

Age IB United Kingdom Australia11–12

MYP

Year 7

Key Stage 3

Grade 6

12–13 Year 8 Grade 7


14–15 Year 10Key Stage 4 / GCSE / International GCSE

Grade 9


16–17Diploma

Year 12 Key Stage 5 AS / A Level /International A Level

Grade 11


*Middle Years Programme (MYP) and Diploma Programme (DP) are trademarks of the International Baccalaureate Organization (IB), which was not involved in the production of, and does not endorse these products. ®IGCSE is the registered trade mark of University of Cambridge International Examinations.

Compare curricula by age, years or grades

All prices displayed in this catalogue are applicable only to schools buying direct from us and reflect a school discount. Prices are subject to change without notice. Prices may vary across regions therefore please contact your local Pearson consultant for local and up-to-date pricing.

Purchasing directly or online is not available in the following countries and markets: Afghanistan, Albania, Armenia, Azerbaijan, Bahrain, Belarus, Bosnia, Bulgaria, Croatia, Czech Republic, Egypt, Estonia, Georgia, Hungary, Iran, Jordan, Kazakhstan, Kosovo, Kingdom of Saudi Arabia, Kuwait, Kyrgyzstan, Latvia, Lebanon, Lithuania, Macedonia, Mexico, Moldova, Mongolia, Montenegro, Myanmar, Oman, Palestine, Poland, Romania, Russia, Serbia, Slovakia, Slovenia, Syria, Tajikistan, Turkmenistan, UAE, Ukraine, Uzbekistan, West Bank Israel, Yemen.

Purchasing online is not available in: Argentina, Turkey and South Africa - please contact your local consultant to order direct.

Purchasing policies, pricing and international restrictions

IndexActiveLearn Digital Service .......................................14 - 15

Changes to the IB curriculum ........................................101

Contact us - customer services .....................................105

Contact us - local representative ..................................105

Digital Resources ...58, 66, 71, 72, 73, 74, 78, 80, 83, 86

Dynamo .................................................................................66

Exploring Science: Working Scientifically ..............34 - 37

iLowerSecondary ........................................................50 - 51

International A Level (IAL) .................................................12

International Baccalaureate .............................................90

International Baccalaureate for the Diploma ..............94

International GCSE .............................................................10

International Maths for the Middle Years.............92 - 93

iProgress ................................................................................. 9

KS3 Exploring History ................................................76 - 77

KS3 Maths Progress ...................................................16 - 19

Languages resources for the new GCSEs.....................74

Lanuages Resources for GCSE (9 – 1)....................74 - 75

Middle Years Maths ...........................................................92

Middle Years Science .........................................................93

New IB resources..............................................................102

New Windmills .............................................................60 - 65

Pearson Baccalaureate ........................................... 94 -103

Pearson Edexcel A Level Biology B .........................48 - 49

Pearson Edexcel A Level Business .........................86 - 87

Pearson Edexcel A Level Chemistry .......................48 - 49

Pearson Edexcel A Level Mathematics AS ............32 - 33

Pearson Edexcel A Level Physics ............................48 - 49

Pearson Edexcel AS and A Level Mathematics ...32 - 33

Pearson Edexcel AS and A Level Mathematics and Further Mathematics (2017) ............................32 - 33

Pearson Edexcel AS and A Level Science .............48 - 49

Pearson Edexcel Core Maths: Maths in Context ........27

Pearson Edexcel GCSE (9 – 1) Biology ....................42 43

Pearson Edexcel GCSE (9 – 1) Chemistry..............42 - 43

Pearson Edexcel GCSE (9 – 1) Combined Science ..........................................................................42 - 43

Pearson Edexcel GCSE (9 – 1) English Language .....................................................................58 - 59

Pearson Edexcel GCSE (9 – 1) French....................74 - 75

Pearson Edexcel GCSE (9 – 1) Geography A and B ....83

Pearson Edexcel GCSE (9 – 1) German .................74 - 75

Pearson Edexcel GCSE (9 – 1) History ...........................80

Pearson Edexcel GCSE (9 – 1) Mathematics ........24 - 25

Pearson Edexcel GCSE (9 - 1) Physics....................42 - 43

Pearson Edexcel GCSE (9 – 1) Science ..................42 - 43

Pearson Edexcel GCSE (9 – 1) Statistics ........................46

Pearson Edexcel International A Level Biology ...44 - 47

Pearson Edexcel International A Level Business ........................................................................86 - 87

Pearson Edexcel International A Level Chemistry ......................................................................44 - 47

Pearson Edexcel International A Level Economics ....................................................................86 - 87

Pearson Edexcel International A Level Information Technology ....................................................88

Pearson Edexcel International A Level Mathematics ................................................................28 - 31

Pearson Edexcel International A Level Physics ...44 - 47

Pearson Edexcel International GCSE (9 – 1) Accounting ...................................................................84 – 85

Pearson Edexcel International GCSE (9 – 1) Biology ..........................................................................38 – 41

Pearson Edexcel International GCSE (9 – 1) Business .......................................................................84 – 85

Pearson Edexcel International GCSE (9 – 1) Chemistry .....................................................................38 – 41

Pearson Edexcel International GCSE (9 – 1) Economics ...................................................................84 – 85

Pearson Edexcel International GCSE (9 – 1) English ...........................................................................54 - 57

Pearson Edexcel International GCSE (9 – 1) English as a Second Language ................................54 - 57

Pearson Edexcel International GCSE (9 – 1) English Language (Specification A) .........................54 - 57

Pearson Edexcel International GCSE (9 – 1) English Language (Specification B) .........................54 - 57

Pearson Edexcel International GCSE (9 – 1) English Literature ........................................................54 - 57

Pearson Edexcel International GCSE (9 – 1) Further Pure Mathematics .......................................20 - 23

Pearson Edexcel International GCSE (9 – 1) Geography ............................................................................82

Pearson Edexcel International GCSE (9 – 1) History ...........................................................................78 - 79

Pearson Edexcel International GCSE (9 – 1) Human Biology ............................................................38 - 41

Pearson Edexcel International GCSE (9 – 1) Information and Communication Technology (ICT) ..................84 - 85

Pearson Edexcel International GCSE (9 – 1) Mathematics ................................................................20 - 23

Pearson Edexcel International GCSE (9 – 1) Physics ...........................................................................38 - 41

Pearson Edexcel International GCSE (9 – 1) Science ..........................................................................38 - 41

Pearson Edexcel International GCSE (9 – 1) Science (Double Award) ............................................38 - 41

Progress Tests ..................... 58, 71, 72, 73, 74, 80, 82, 83

Resource Finder .................................................................... 2

Secondary School Year / Grade correlation...............104

Skills for Writing...........................................................52 - 53

Stimmt! (German) ...............................................................72

Studio (French) ....................................................................71

UK A Level .............................................................................13

UK academic curriculum ..................................................... 8

UK GCSE ................................................................................11

Viva! (Spanish) ......................................................................73

Contact UsYour Local Pearson RepresentativeTo find details of your local Resources and Edexcel Qualifications Representatives, go to www.pearsonglobalschools.com/contact and simply find your country from the drop down list.




Your Customer Service TeamProduct Orders For print product orders, email: [email protected]

For digital product orders, email: [email protected]

For digital product technical support, email [email protected]

For any other enquiries please visit www.pearson.com/uk/contact-us.html

Product QueriesFor print product queries, email: [email protected]

For digital product queries, email: [email protected]

If you like what you see here, then there’s a lot more online at www.pearsonglobalschools.com

BrowseSearch by subject or individual product using the simple search panel. You can also view the online catalogues and download price lists.

SampleEvaluate online at your own pace, anytime, anywhere, with access to samples, free trials, demos, full component listings, structure charts and overview videos.

Stay ConnectedSign up for our eNewsletters and eAlerts to keep fully up to date with the latest news, features and offers.

Follow us on Facebook Stay ahead and join the conversation. Search for @PearsonInternationalSchools.


Next steps

Pearson Global Schools. Bringing you the very best primary and secondary school resources, from around the globe, to help your learners flourish.

When you have finished with this catalogue please recycle it

International Secondary Catalogue 2019

Documents

Transcript of International Secondary Catalogue 2019