Honoring Artists & Their Patrons

THURSDAYMarch 3,

2016Vol. 116, Issue 39

Published inBerea, Kentucky, U.S.A.

Inside

Deadlines• Noon on Monday

for news submissions, announcements,calendar items,

letters to the editor.

• Noon on Tuesday for all advertising.

Our Staff

Teresa Scenters,

Publisher

Beth Myers,

Editor

Kim Kobersmith,

Critley King

Reporters

Keeley Johnson,

Circulation & Classifieds

Sheila Johnson,

Advertising

Timothy Pack,

Graphic Design

50¢ Newsstand

Plac

e m

ail l

abel

her

e

Contact Us

Berea Citizen711 Chestnut Street

Suite 2Berea, KY 40403

Ph:859-986-0959Fax: 859-986-0960

Email: [email protected]

B1

Proudly serving the people of Southern Madison County since 1899

Obituaries ................A2Opinions ................. A4Classifieds .............. A6Living .......................B1Church Listing ..........B4Calendar ...................B5Public Record ............... B6 Reflections .................... B8

Madison Southern swimmers go to

State Swim Meet for first time.

Berea Police Develop Smart Phone App for Better Communication

By Beth MyersCitizen Editor

Six choir students from Farristown Middle were named to the Kentucky All

State Choir this school year, twice as many as last year.

“I was so thrilled, and proud of them,” Christie Tate, the choral director at Farristown said.

Last year, Erica Hellard, Andrew Breakall, and Se-renity Lamb, all current eighth graders, were named to the All State Choir. They


Sarah Culbreth from Tater Knob Pottery re-ceived the Artist of the Year award at the Stepping

Out for Art event Satur-day night, and John Bolin received the Community Arts Award.

This is the first year that the Berea Arts Coun-cil (BAC) has given these

awards; the organization plans to make it an annual event. Staff and the board members of BAC have been soliciting nomina-tions for several months, and made the announce-

ment of the winners at their annual fundraiser – Stepping Out – on Feb. 27.

“A panel of five review-ers including working art-ists, educators, and com-munity members met and

considered the nominees,” Gwen Childs, the execu-tive director of the Berea Arts Council, said at the awards ceremony dur-

Berea Business Goes Non-Traditional

This is the last article in a three-part series that takes a serious look on the feasibility of bringing dif-ferent business to Berea. This third one focuses on non-traditional business.

By Kim KobersmithCitizen Reporter

Their certified kitch-en is in a side room

SEE ARTS, PAGE A9

SEE BUSINESS, PAGE A9


A new app for smart phones is being devel-oped by the Berea Police Department, to help com-munication with the com-munity.

Chief of Police David Gregory introduced the new app to Berea City Council on Tuesday eve-ning, and said it was still in the design phase.

“We hope this will build better communication with the community,” Gregory said, “to let them know what’s going on, as well as hearing from them.”

Gregory said he’s par-ticularly excited about one of the tabs on the app, for alerts to the commu-nity. People with smart phones can receive alerts about active shooters, closed streets, and other emergencies through this tab. Gregory reported that they would receive this alert even quicker than on Facebook.

Other tabs on the app include a locator, so peo-ple can call the police and pin their location within the city so police can find

them. Reports and photos can be sent to the police regarding suspicious ac-tivity, and forms can be accessed for civilian acci-dent reports, parade ap-plications or Residence Watch.

Gregory said the Resi-dence Watch forms are very cumbersome, so it will be much easier for residents to sign up for the service on the phone. Res-idence Watch is for people who will be out-of-town for an extended period of time, who would like the police to keep an eye on their home.

The Berea Police are using a developer who specializes in doing these types of apps for po-lice departments. It cost around $1,100 for devel-opment and $1,000 in an-nual maintenance. Coun-cil member Jerry Little said this seemed like a very low price for the ser-vice.

Gregory hopes the app will be ready to use by mid-March.

Mayor Steve Connelly reported that different citizens asked him about

Farristown Singers go to All-State

Honoring Artists &

Their Patrons

Photo Submitted

First Time Ever, Berea Community

Student Wins Children’s

Champion Contest Isaiah Lewis, a third-grader from Berea Community, standing with FRYSC Director Diane Smith, was the winner of the Children’s Champion award, a county-wide contest where elementary school students compete to have their drawing selected as the Children’s Champion picture for the year. Isaiah is the first student from Berea Community to have his drawing selected as the winner, in the 20 year history of the contest. He was given his certificate Wednesday at school, and he also received congratulations at city council on Monday evening. Isaiah’s drawing will now be put up on three billboards around Madison County; at Safety City, and two near Highway 25.SEE APP, PAGE A9

SEE SINGERS, PAGE A9

Sarah Culbreth, left, and John Bolin, right, were honored Saturday night at the Stepping Out for Art event, held by the Berea Arts Council (BAC). Gwen Childs, executive director of BAC, presents their awards to them. Sarah received the first ever Artist of the Year Award, and John received the Community Arts Award.

Photos by Beth Myers/The CitizenSix choral students from Farristown Middle were selected for the Kentucky All-State Choir, and they performed at the Kentucky Music Educators Association conference on Feb. 4. There were 1,200 students who sent in auditions for the Kentucky All-State Choir, but only 200 were selected. The students said it was “overwhelming, but in a good way.” From left to right are Choir Director Christie Tate, eighth grader Erica Hellard, eighth grader Kayleigh Jackson, eighth grader Andrew Breakall, seventh grader Trinity Strong, seventh grader Kaylee Kapp, and eighth grader Serenity Lamb.

Whittamore Still Preaching at 90 Years


Charles Whittamore remembers driving to Richmond, or “to town,” once a year when he was growing up, and just looking around, amazed.

“We’d hook up our horse and bug-gy, to take that trip,”

SEE CHARLES, PAGE A10

Davis & PowellF U N E R A L D I R E C T O R S

616 Chestnut Street, Berea(859) 986-3115 or 986-4220

www.davisandpowellfuneralhome.com

Located in a quiet residential area -Convenient and easily accessible.

Jim DavisGreg Powell

A2 The Berea Citizen Thursday, March 3, 2016Obituaries

LAKES FUNERAL HOME Serving Berea’s Families Since

203 North Dogwood, Berea, Kywww.lakesfuneralhome.com

(859) 986-8416 • 1-800-307-0463

All pre-planning and cremation services available.1988

Shelley Lakes JenningsFuneral Consulatant/

Owner

Janel Lakes DavenportFuneral Director/

Owner

Manuel LakesFounder/Funeral Director

Greg LakesFuneral Director/Embalmer/Owner

Arlie “Duke” Combs, 66, of Berea, died Satur-day, Feb. 27, 2016 at St. Joseph East Hospital. A native of Hazard, Mr. Combs was the son of the late Andrew and Virtue Pratt Combs.

Mr. Combs was a re-tired truck and school bus driver for the Madison County Board of Educa-tion, and a member of the Berea Evangelistic Center. He served his country in the United States Army. He loved his family, and fishing.

Mr. Combs is sur-vived by his wife, Terri Elam Combs. He was the loving devoted fa-ther and grandfather to one daughter, Bridget (Keith) Owens; one son, Shannon Combs; three grandchildren, Zachary Lynn, Lyndsey Dawn and Kaylee Lynn Combs; two step granddaughters, Fe-licia and Joanne; four step

grandsons, Johnny, Land-on, Ryan and Keaton; two special friends, Jerry Wil-liams and George Smith; and three sisters, Sue Wil-liams of Richmond, Char-leen (William) Shelton of Berea, and Betty (Charlie) Chasteen of Berea. His faithful dog, Tillie also survives.

He was preceded in death by siblings, Brenda and Janice Combs, Cleda Everidge, Darlis Ambur-gey, and Donnie Combs.

Funeral services will be 1 p.m. on Saturday at the Davis & Powell Fu-neral Home with Bro. Dan Gibson officiating. Entombment will follow in the Berea Cemetery mausoleum. Visitation will be from 5 - 9 p.m. on Friday. Pallbearers will be Jeffery Hume, Oscar Combs, Dwayne Shelton, Johnny Everidge, Danny Everidge and Steven

Cummins. Honorary pallbear-

ers will be Jerry William, George Smith, Quintin and Chuck Elam. www.davisandpowellfuneral-home.com

Arlie “Duke” Combs

Mary Marie Carter Carpenter

Tim L. Boyer, 70, of Berea, passed away Monday, Feb. 29, 2016 at the Hospice Compas-sionate Care Center in Richmond.

Tim was born in Camden, Ark. to the late Gerald and Mildred Elliott Boyer. He was a truck driver for National Distributors, and a U.S. Navy veteran. He was a member of the Emmanuel Baptist Church.

In addition to his parents, Tim was preceded in death by two brothers, Gerald “Buzz” Boy-er, Jr., and Jim Boyer; and his father-in-law, Verlin Wright.

He is survived by his wife, Karen Boyer; three children, Stephen (Shonda) Boyer, Stephanie (David) Staggs, and Brooke (Joe) Bent-ley; his mother-in-law, Dorothy Wright; six grandchildren, Bran-don (Kelly) Staggs, Bryan (Karie Howell) Staggs, Kinsey Boyer, Kailey Boyer, Chase Bentley and Christopher Bentley; and numer-ous nieces and nephews.

Funeral services will be 11 a.m. on Thursday, March 3, 2016 at Emmanuel Baptist Church with Rev. Joey Kays and Bro. Donnie Closterman officiating. Burial with military honors will follow in the Flatwoods Cemetery. Visitation will be Wednesday evening from 6-8 p.m. at Emmanuel Baptist Church.

Active pallbearers will be David Staggs, Joe Bentley, Brandon Staggs, Bryan Staggs, Chase Bentley, Christopher Bentley, Kinsey Boyer and Kailey Boyer. Honorary bearers will be Greg Reynolds, Hurston Holt, Ed Miller, Ford Thompson, Dennis Grant, Mike Dowling and Donnie Closterman. Condolences may be left for the family at www.lakesfuneralhome.com In lieu of flowers, dona-tions may be made to Hospice Care Plus.

Sherman Ponder, Jr., 68, of Berea, passed away Monday, Feb. 22, 2016 at the Hospice Care Center in Lexington. He was born in Rockcastle County to the late Sherman Sr. and Gladys Kirby Ponder.

Sherman was a U.S. Army veteran. He served his country in Vietnam and South Korea.

Sherman was a retired phone technician for AT&T, where he worked for 30 years. He was a member of the AT&T Life Pioneers, and American Legion. He had been an ordained minister since September 15, 1985. He played bass guitar with

the Bethel Gospel Lights. In his free time, Sherman loved to hunt; he was an avid fisherman.

In addition to his par-ents, he was preceded in death by three brothers, Ralph Ponder, Donald Ponder, and Larry Ponder.

He is survived by his wife of 49 years, Sue Ste-phens Ponder; his daugh-

ter, Leann (Bryan) Simp-son; his brothers, Kenneth (Sandy) Ponder, Lee (Lynn) Ponder, Jim (Di-ane) Ponder, and Michael (Jeanie) Ponder; three grandchildren, Blake, Ad-dison, and Ayden Simp-son; and numerous nieces and nephews.

Funeral services were at 11 a.m. on Friday, Feb. 26, 2016 at Lakes Funeral Home with Rev. Kenny Davis officiating. Burial with full military honors followed in Berea Cem-etery. Pallbearers were Jim Ponder, Kenneth Pon-der, Michael Ponder, Lee Ponder, Kenny Stephens, Matthew Stephens, Joseph

Keith and Blake Simpson. Honorary bearers were Bryan Simpson, Phillip Ponder, Jimmy Lakes, Lee Keith, Paul Coomer, Dale Croucher and Steven Shel-ton. www.lakesfuneral-home.com

Elvin Combs, 92, of Berea, died Tuesday, Feb. 23, 2016 at the Uni-versity of Kentucky Medical Center in Lexington. A native of Happy in Perry County, he was the son of the late William B. and Beatrice Combs.

For 41 years, Mr. Combs served as the equipment manager at Berea College. He was a member of the Richmond Church of Christ, and the Mountaineer Hall of Fame. He was also a Kentucky Colonel. Mr. Combs was an avid squash and racquetball player, and he loved to fish and raise a garden. He was known to help coach as well.

Mr. Combs is survived by his wife of 70 years, Bette Ush-er Combs of Berea; his daughters, Jane (Ray) Brandenburg of Berea, and Edie (Earl) McCreary of Rockwood, Tenn.; his sons, John E. Combs of Richmond, and Larry (Dulce) Combs of Berea; his grandchildren, Tamara DeBord, Tina (Dale) Carter, E. T. McCreary, Emily Arp, Larinda (Andy) Agee, Eric (Savannah) Combs, Brian (Jennifer) Combs and Tracy Jane Combs; 15 great grandchildren; and seven great-great grandchildren.

He was preceded in death by a son, Jerry Combs; two brothers; and two sisters.

Funeral services for Mr. Combs were at 2 p.m. on Sun-day at the Richmond Church of Christ in Richmond with Bro. Jack Hall, Bro. Mike Johnson and Rev. J. Randolph Osborne officiating. Burial followed in the Combs Family Cemetery. Pallbearers were Dave Shelton, David Olinger, John Stephenson, James “Bones” Owens, Wally Campbell, Steve Connelly, Everett “Mutt” Varney, and Mike Johnson. Honorary pallbearers were Budd Abbott, Chuck Eckler, Gov. Martha Layne Collins, Gov. Paul Patton, Judge Bill Clouse, Coy Hamblin, Randy Osborne, Bob Miller, Cy Richardson, Doug Hazelwood, Hubert Calahan, Russell Hehemann, Eddie Pullins, Dillard Feltner, Mike Potter, Jim Harrison, Dale Carter, Ray Brandenburg, Eric Combs, Brian Combs, Tyler McCreary, Oscar Combs, Paul Combs, Ben Hoffman, Judge Wilson, President Lyle Roelofs, Ken-neth Tate, Randy Kates, and Mitchell Smith.

Expressions of sympathy may be made to the Combs Family Cemetery, % Jane Brandenburg, 1121 Highway 1016, Berea, Kentucky 40403. Davis & Powell Funeral Home is in charge of the arrangements. www.davisand-powellfuneralhome.com

Sherman Ponder, Jr.

Mary Marie Carter Carpenter, 83, widow of Coleman Cash Carpen-ter, went peacefully to her heavenly home on February 24, 2016 at the Compassionate Care Center in Rich-mond.

She was born on March 27, 1932 to the late Allie and Emma Burns Carter in Madison County.

Mary was a loving mother, grand-mother, great grandmother, sister, aunt, and friend. She was faithful to her Lord, and was a light to all who knew her. She loved her church family dearly, which included several churches she regularly attended, but especially loved her home church, 1016 Holiness Church.

She is survived by her six sons and their wives, Keith and JoeAnn, Steve and Linda, Doug and Audrey, David and Staci, Chris and June, and Kenny and Brenda, all from Berea; 14 grandchildren; and 18 great grandchildren.

She is also survived by three sisters, Faye Million from Mason, Ohio, Daisy King from Berea, and Janice McBride from Alvin, Ill.; and two brothers, Bruce and Ralph Carter from Berea.

In addition to her husband, she was preceded in death by one great granddaughter, Brooklyn Durham; three sis-ters, Maxine Eaton, Dorothy and Evelyn Carter; and four brothers, Raymond, Doug, James and Martin Carter.

Funeral services were at 1 p.m. on Monday, Feb. 29, 2016 at Lakes Funeral Home with Bro. Leonard Wilder, Bro. Larry Gray, Bro. Dudley Lynch and Bro. George Mullins officiating. Burial followed in the Berea Cemetery.

Pallbearers were Senator Jared Carpenter, Michael Carpenter, Tony Dillon, Kendall Bailey, Jon Barnett, and Shawn Durham. Honorary pallbearers were the pastors and church families of 1016 Holiness Church, and the oth-er local churches that she attended.

In memory of Mary, donations may be made to the Hos-pice Compassionate Care Center.

www.lakesfuneralhome.com

Geraldine Mason Tim L. Boyer

Elvin Combs

Geraldine Alexander Mason of Berea, died Friday, Feb. 26, 2016 at Arcadian Cove Assisted Living in Richmond. She was a lifelong resident of Madison County, born on December 24, 1936.

Geraldine was the daughter of the late Wil-liam Oscar and Eva Coyle Alexander. She was a retired Parker Seal Company employee, and attended Westside Baptist Church.

Survivors include her son, Garrett (Sha-ron) Mason; grandson, Jeremy (Brandi) Ma-son; two brothers, Wade (Carolyn Schaefer) Alexander and Hansel (Susan) Alexander; and numerous nieces, nephews, relatives and friends. In addition to her parents, she was preceded in death by three siblings, Christine Beaty, Wayne Alexander, and Ed-ward Alexander.

The funeral service took place at 1 p.m. on Tuesday, March 1, 2016 at Reppert Funeral Home with Pastor Allen Livingood officiat-ing. Burial followed in Berea Cemetery. Pall-bearers were Jeremy Mason, Danny Rose, Wade Alexander, Jr., William Alexander, Hansel Alexander and Wade Alexander.

In Memory of

Clifford IngramBorn 3-6-59 — Died 7-4-07

Eva M. YoungerBorn 3-8-21 — Died 6-28-14

YOU BOTHhave been gone so long, but we think of you each and every day.

Now all we have are memories & pictures – but we thank God for them.

But we loved both of you very much.

Happy Birthday!

The Ingram FamilyRoy & Lucy, Wanda, Angie, Brandy, Jeff & Family, Rick & Family

We would like to thank everyone

who brought flowers, food,

prayed or helped in any way during

the loss of

BonniePowell Rice

Thank You!

The family of Bonnie Powell Rice and

The family of John Leigh Powell

A3 The Berea Citizen Obituaries Thursday, March 3, 2016

Donald Wayne Carpenter, 60, of Waco, passed away Friday, Feb. 26, 2016 at St. Joseph Hospital in Lex-ington. He was born in Berea to the late Katherine Friend Carpenter and Carl Carpenter.

Donald was a self-employed landscaper, and member of the Baptist faith.

In addition to his mother, he was preceded in death by his first wife, Alice Carpenter; one sister, Noretta VanWinkle; and one nephew, Zachary Croley.

He is survived by his wife, Mary Carpenter; his fa-ther, Carl Carpenter; two daughters, Kelly (Jon) Wal-ters and Kristina (Craig) Vinson; five siblings, Charles (Marsha) Carpenter, Mary (John) Jane Bowman, Diane (Teddy) Croley, Wanda (Philip) Hurt, and Pete (Rhon-da) Carpenter; one grandson, Sam Walters; and one brother-in-law, Allen VanWinkle. Many nieces and nephews that he was close to and loved dearly also survive him.

Funeral services were at 7 p.m. on Tuesday, March 1, 2016 at Bethel Baptist Church with Rev. Kenny Davis officiating.

Condolences for the family may be left at www.lakesfuneralhome.com

Janice Dale Neeley Farmer

Janice Dale Neeley Farmer, 67, died Wednesday, Feb. 24, 2016 at Madison Health & Rehab in Richmond. She was a native of Berea, born to the late Floyd D. & Tempie Vola Burnell Nee-ley.

Mrs. Farmer was of the Baptist faith and loved crafting.

Other than her parents, she was preceded in death by a brother, Den-ver James Neeley; and a sister, Betty Carolyn Neeley Locke, and her former husband, Donald R. Farmer.

Mrs. Farmer is survived by her children, Trenda (Ray) Joyce Farmer King of Mt. Vernon, and James Thomas Farmer of Carrollton; her brother, William Thomas Nee-ley of Oklahoma City; and one granddaughter and one great granddaughter, Crystal Lyndale Farmer Isaacs and Hannah Marie Isaacs.

Funeral services were at 1 p.m. on Friday, Feb. 26, 2016 at the Davis & Powell Funeral Home with Rev. Kenny Felty officiating. Burial followed in the Madison County Memorial Gardens. www.davisanpowellfuneralhome.

Wanda E. Johnson

Wanda E. Johnson, 83, of Berea, died Monday, Feb. 29, 2015 at St. Jo-seph Hospital in Lexington. A native of Rockcastle County, she was the daughter of the late Roy Talmage and Fabra Branaman McCracken.

Mrs. Johnson was a housewife and a member of Silver Creek Baptist Church. She loved the Lord and life itself. She had a great love for her family and tried to set a good example for them to follow.

A big prankster, Mrs. Johnson was an avid fan of UK basketball and gospel music. She liked to raise a garden, flowers, and she liked to go fishing. For over 30 years, she, her sister, and friends made an annual trip to Gatlin-burg.

Mrs. Johnson is survived by her husband of 65 years, Harold D. Johnson of Berea; her daughters, Mildred (Eddie) Kay Wilmot, Judy (David) Faye Pingleton, and Lisa (Tony) Lynn Wherle, all of Berea; her sisters, Donna (Lynn) Marie Weaver of Richmond, and Marilyn (Gro-ver) E. DeWitt of Berea; her brother, Roy (Bonnie) Lee McCracken of Berea; her grandchildren, Becky (David) Renee Stone of Berea, Paula (Allen) Gail Livingood of Berea, Dr. Dawn (Josh Reardon) Elaine Pingleton of Pa-ducah and Berea, and Jared Davis Wehrle of Berea; her great grandchildren, Kyle Edward Reece, Cayle Grace Reece, Frederick Alan Livingood III, Victoria Rae Livin-good, Kolt Wehrle, Korbin Davis Werhle, and Kash Weh-rle; and special friends, Leonard and Kathy Bratcher.

Funeral services for Mrs. Johnson will be 11 a.m. on Thursday at the Silver Creek Baptist Church with Rev. Dennis Hisle and Bro. Jeff Reed officiating. Burial will follow in the Berea Cemetery. Visitation will be from 5-8 p.m. Wednesday at the church. Expressions of sympa-thy may be made to Hospice Care Plus, 208 Kidd Drive, Berea, Ky. 40403.

Pallbearers will be Tony Wehrle, David Pingleton, Ed Wilmot, Kenny Hylton, Brad Hylton, and Mike Coyle. Honorary pallbearers will be Leonard Bratcher, Jared Wehrle, Kenton Davis, Kent Clark, Allen Livingood, Trey Livingood, Kyle Reece, Wayne Abrams, Art VanWinkle, Robert Jones, Buddy Montgomery, and Benny Gay. Da-vis & Powell Funeral Home is in charge of the arrange-ments. www.davisandpowellfuneralhome.com

Thank You To The Sponsors OfThe Berea Arts Council’s

Stepping Out For Art 2016

Kenny Barger IIMayor Jim Barnes

Doug & Nancy HindmanDiane Kerby

Joyce MosherBarbara Prairie

Citizens Guaranty Bank Craig Loftis State Farm

D&B ElectricHoliday Inn Express

Jennifer Napier Career ConsultingKentucky Farm Bureau – David

MayoKnight’s Pharmacy

Lakes Funeral HomeMaxam Family Dental

Steven Connelly, AttorneyJohn and Ramona Culp

Aimee Russillo

Nancy Naumer & Muse WatsonPark Federal Credit Union

Peoples Bank of Madison County

FRIENDSPeggy Baker

Thomas & Joy FrazierKandi Hylton

Roy & Anita ToddBarbara Wade & Randall Roberts

SUPPORTERS

GOLD SPONSORSThe Churchill Co.

Kip Kelley – The Motorcycle GuyCecile Schubert

SILVER SPONSORSBaptist Health

Community Trust BankDinner Bell Restaurant

Novelis

BRONZE SPONSORS

St. Clare Catholic Church

24 Hours for the Lord | 24 Horas para el Señor

Join us as we reflect on and celebrate the great gift of God’s mercy and forgiveness.

Ven a reflexionar y celebrar el gran don de la misericordia y el perdón de Dios.

Friday, March 44:00 - 5:30 pm Adoration and Confessions5:30 pm Liturgy of the Hours: Evening Prayer6:00 pm Meal (potluck – no meat) | Cena7:00 pm Film on Laudato Si with a discussion8:00 pm Mass | Misa8:45 Divine Mercy Chaplet9:00 pm Stations of the Cross in English9:30 pm Via Crucis en español10:00 pm – Midnight TaizéMidnight – 7:00 am Adoration | Adoración

Saturday, March 57:00 am Liturgy of the Hours: Morning Prayer7:30 am Rosary8:00 am Mass | Misa9:00 – 10:30 am Confessions | Confesiónes10:30 am – 3:00 pm Spring Church Clean-Up | Limpiar la Iglesia12:00 – 12:30 Lunch | Almuerzo1:00 – 3:00 pm Altar Server training3:00 - 4:00 pm Adoration, Confessions | Adoración, Confesiónes

622 Chestnut Street • Berea, KY 40403 | (859) 986-4633

FRIDAY FISH FRYSaint Clare Church

622 Chestnut Street

Friday March 11 & Friday, March 18, 2016from 5:00 to 7:00 pm

Come enjoy a meal of delicious fish, vegetables, desserts and drinks.

Take Out AvailableFree will offering will be accepted.

Kindergarten RegistrationFriday, March 11, 2016Friday, March 25, 2016Friday, April 22, 2016

8:00am – Noon & 1:00pm – 5:00pm

Central Office Conference RoomItems to bring that day

Birth Certificate, Immunization Certificate, Health Exam, Eye Exam, Dental Exam, Address Verification

(For Example: Gas, Electric, Water, Phone Bill orRent/Lease Agreement)

Any questions please call:859-986-8446

Berea Independent Schools3 Pirate Parkway, Berea KY 40403

Jeffrey Clay Martin, 53, of Three Links, went to be with the Lord on Friday, Feb. 26, 2016 at Baptist Health in Richmond. He was born in Berea to Darlene Davis Martin and the late Gene Martin.

Jeffrey was employed by Ener-sys Corp., and loved farming and cattle. He was a member of Three Links Christian Church. His love for the Lord and his family were the most important things in his life.

He is survived by his loving wife, Judy Martin; his mother, Darlene Martin; his sons, Justin (Becca) Clay Martin and Joshua Adam Clay Martin; one daughter, Jeanette (Jeff) Bowles; five siblings, Ann (Russell) Bar-ron, Marita (Dallas) McGuire, Jerry (Debra) Martin, Ruth (Dennis) Venable, and David (Shawnda) Martin; two grandchildren, Easton Clay and Anna Beth Grace Martin; and a host of nieces and nephews.

Funeral services were at 12 p.m. on Wednesday, March 2, 2016 at Three Links Christian Church with Bro. Grant Martin and Bro. James Ballinger officiating. Burial followed in the Phillips Cemetery. Pallbearers were Justin Martin, Josh Martin, Jerry Martin, David Martin, Matt Martin and Dawson Martin. Honor-ary bearers were Grant Martin, James Ballinger and Mike Lopez.Condolences may be left for the family at www.lakesfuneralhome.com

Jeffrey Clay Martin

Donald Wayne Carpenter

Berea Citizen,Always Local,Always There

“Congress shall make no law respecting an establishment of religion, or prohibiting

the free exercise thereof; or abridging the freedom of speech, or of the press; or the right

of the people to peacefully assemble and to petition the government for a redress of

grievances.” — The First Amendment

the

Proudly serving the people of Southern Madison County since 1899.

Berea

“Let us not be weary in well doing, for in due season we shall reap if we faint not.”

- Galatians 6:9

The Berea Citizen (USPS 113-380) is published every Thursday in Berea, Ky., the ‘Gateway to Appalachia.’ Periodicals postage is paid at the Berea

Post Office and at additional mailing offices. Postmaster: Send address changes to The Berea Citizen, P.O. Box 207, Berea, KY 40403. The Berea

Citizen is a member of the Kentucky Press Association. Advertisers should check their ad the first day it appears in the paper (Thursday).

The Berea Citizen shall not be liable for failure to publish an ad or for a typographic error(s) in publication except the extent of the cost of the ad

for the first insertion. Adjustments for errors are limited to the cost of that portion of the ad wherein the error occurred. We reserve the right to edit

or change any submitted information. © 2016 Berea Publishing, Inc.

ScenterStage

Teresa Scenters,Publisher

Letters to the editor must contain no more than 500 words. Writers are limited to a maximum of 3 letters in a 3 month period. Letters are published

in the order in which they are received as space permits. Letters must not contain libelous materials. All letters MUST include the author’s name, address, and telephone number or email address for verification purposes. Illegible or incoherent letters will not be considered for publication Letters

which do not meet these guidelines will neither be published nor returned to the author. For questions contact the editor at 986-0959.

Thursday, March 3, 2016 Page A4

From our readers

What Do You Know? The photo to the right from War-ren Brunner’s ar-chives show three Bereans. Can you identify who they are, and why they might be photo-graphed togeth-er?

Thwart mass murder by abolishing gun free zonesDear Editor,

We noted recently Ms. Myers’ appeal for letters to the editor. Never to leave a damsel in distress, I once again lay down the plow and take up the pen to pass along a legislative item the community should let their servants in Frankfort know they support.

State Representative Tim Moore’s House Bill 221 would end the reck-less prohibition against concealed carry by per-mit holders in Kentucky’s

public schools and uni-versities. There is another piece of legislation which has been authored in the house (HB-270) which is riddled with naive restric-tions upon concealed carry in schools and universities.

As has been proven in many parts of the country (particularly by Stalinist politicians in DC and NYC as demonstrated with their well armed protection de-tails), there isn’t a warp in the space-time continuum over Walmart that makes concealed carry work

perfectly fine there but somehow “dangerous” on school grounds.

The logical answer to thwarting mass murder is abolishing so-called “Gun Free” zones. As with the Democrat Party’s uncon-stitutional “No Negroes” signs of the past, their “No Guns” signs belong upon the trash heap of history as well.

Shane Morris

Berea

Ode to a DandelionWonder about life,that amazing, wondrous affairthat we take so for granted, incomprehensible andmiraculous though it might be?

The dandelion is a case in point. That plant that dares to raise its headin the least expected of places,whether in a crack in the pavement,in an otherwise solid green, manicured lawn,or even in a junk yard,amongst ruined or antiquated parts.All the dandelion seems to requireis a wee bit of sun, soil and waterfor it to sprout and flourish.

The dandelion:roots buried deep;long, green toothed leavesheld out to catch the dew;sun-yellow, multi-layered, star-shaped flowersheld high on slender stemswaving in the breeze;and, with time,fragile puff-balls of seeds,each with a tiny parachute-stemto be flown far-afield by the wind-or children blowing.All these parts,perhaps save the seeds,a vitamin rich sourceof nourishment for us other.

This dandelion, this “weed,”the bane of mankind,the scourge of gardeners everywhere

who strive for neat perfection.It dares arise anewseemingly obviousof the consequencesmost likely meted out.

With so many starving in the world,we yank, poison, trod,and otherwise do our darndest,to get rid of this simple,and yet elegant, dandelion.This tenacious, hardysource of beauty and nutritious food,suffers in silence(to our ears at least)as it is systematically killed.

Makes me wonderwhere our priorities lie.

Instead of celebratingand cherishing this wonder of lifewe try our best to destroy it.

But, perhaps I shouldn’t be surprisedat our wanton waste.This is just a symptomthat portrays other areas wherewe grab, drill and bulldozeto get what we want,regardless of consequentialdestruction or losses.

Tears flow for us all.When will we wake up --?

Elizabeth LongBerea

To the Editor and our fel-low Bereans,

Since we arrived at Berea College, we have been emphasizing the value of regular exercise as one ele-ment of a healthy life. You may have heard that mem-bers of the college commu-nity get together a couple of mornings each week in order to walk or run to-gether.

Of course, many mem-bers of the college com-munity find other ways to be physically active, but many of us have enjoyed meeting at 7 a.m. on Tues-day and Thursday morn-ings. We gather in the Sea-bury Athletic Center lobby and walk or run out along the Beebe-White bike trail

toward the Artisan Center. Going that full distance re-sults in a running round trip of a bit over four miles.

Others, mostly the walk-ers, go as far as Middle-town School and turn around there for a round trip of two miles. Some community members have joined in this activity, and we just want all others to know that all are welcome.

There is something pret-ty special about the com-pany of people you exer-cise with. (Leashed) pets are welcome, too. We usually provide bananas and granola bars, in case you need a little bit of extra fuel, and unless it is cold outside, we also put up a water station at Middle-town School.

This group meets to run or walk throughout the fall semester, but takes a break from outdoor running from Christmas through Spring Break. We will re-sume on Tuesday, March 15, and continue until the end of the spring semes-ter. We go in any and all weather conditions (except for thunderstorms), but the indoor track in Seabury Center is always available if outdoors seems to un-comfortable.

Please join us if you are so inclined,

Lyle and Laurie Roelofs (and the other members of the

BC Run Walk Club)

P.S. Running t-shirts are provided to regulars

What a lovely invita-tion to the community is the letter from President and Mrs. Roelofs. Putting legs (no pun intended) on inclusion and not just pay-ing it lip service. It’s easy to buy the lie that feel-ings of exclusion are the sole purview of those in racial or religious minor-ity groups. Truth be told, most feel the sting of it, in one way or another.

Wouldn’t it be wonder-ful if the much varied population of this town could indeed feel a part of the big picture of who we are as Bereans? How sad that including the work-ing class and the business community doesn’t seem to be the goal from the ex-ecutive seat.

To say I was stunned to read a draft of an agree-ment that was appar-ently put together by the mayor and the Berea Hu-man Rights Commission regarding the Spoonbread Festival is an understate-ment. I can tell you that the board of directors of

the Berea Chamber of Commerce as a group sees it as pure and simple bullying. It’s hard to un-derstand why the most successful event in Berea would be singled out for unenforceable, not to mention unconstitutional, regulation. To add insult to injury, a member of the HRC reportedly posted the thing on social media well before it was even presented to the chamber director.

As best I can tell, this vendetta began with a demonstration by that same HRC member and a little group of protest-ers who interrupted the Spoonbread Festival pa-rade this past year. Their gripe was ostensibly that Confederate memorabilia was being sold by some of the vendors. And I’m told they were correct. Ironi-cally the two vendors who had the items were appar-ently an African American and an Asian.

I realize that an event for the working class, who spend their days laboring in the factories and res-taurants and pay those oc-cupational licensing fees that keep this town going, does not play well into the image of Berea that is promoted by the city.

Nonetheless, the Spoon-bread Festival unarguably brings more people to town for those three days in September than any other.

It’s a monumental feat that involves contribu-tions from many local business people and much hard work from the tiny three member staff of the Chamber, not to mention the army of volunteers that gladly donate their time for this community event. Ask any local res-taurateur; they can tell you about the welcome added business the fes-tival brings. The city has certainly been an instru-mental partner in bring-ing it this far. Seems like a no brainer to continue that support, especially since every dollar spent by those attendees is a shot in the arm of the local economy.

In the early years of the festival I was among the people who thought it would be another of those events to quickly go into decline and die a natural death. As it turns out the Spoonbread Festival con-tinues to grow and has outlived all sorts of other attempts to draw people to Berea. It would be a shame to see it moved.

Invitation to join in communal walk/run

Concern for Future of Spoonbread Festival

from the Warren Brunner collection

INTERLOCAL C OOPERATION AGREEMENT CREATING THEKENTUCKY MUNICIPAL ENERGY AGENCY

ARTICLE IIPURPOSES AND POWERS OF THE AGENCY; AGANCY PROJECTS

Section 1. Purposes of the Agency. The Agency is formed to allow the Members to effectively collaborate to do all things necessary or convenient to serve the current and future electric power and energy require-ments of the Members and to otherwise provide assistance to the Members related to their electric power and energy utility systems.

Section 2. Powers of the Agency. In order to carry out the purposes of the agency set forth herein, the Agency shall have the following powers:

(a) to plan, finance, acquire, construct, purchase, manage, operate, transmit the output of, maintain, use, share the cost of, own, lease, sell or dispose of any electric power supply project of projects and any and all facilities, including all equipment, structures, machinery, and tangible property, real and personal, for the generation or transmission of electrical energy, or both, including any fuel supply or source or acquisition of fuel or facilities for the production, transportation, handling, utilization and storage of fuel, either by itself or with other electric utilities or groups of utilities, within or without the Commonwealth of Kentucky;(b) to investigate the desirability of and necessity for additional sources and supplies of electrical en-ergy and fuel of any kind for such purposes and transmission facilities therefore, and conduct studies, surveys and analyses as may be necessary to determine the feasibility and cost thereof;(c) to cooperate with other persons or other entities, public or private, in the development of sources and supplies of electrical energy and fuel of any kind for such purposes and transmission facilities therefore, and give assistance, financial or otherwise, in any such development;(d) to apply to any person or other entity, public or private, for consents, permits, authorizations or ap-provals required for any project undertaken in accordance with this Agreement and take all actions necessary to comply with the conditions thereof;(e) to acquire, hold, use, and dispose of income, revenues, funds and money;(f) to exercise all powers in connection with the authorization, issuance and sale of bonds and bond anticipation notes as are conferred by the Act, and by such other applicable statutes as may presently exist or hereafter be adopted;(g) to invest money of the Agency not required for immediate use, including proceeds fro the sale of any bonds, in such obligations, securities, and other investments as authorized by applicable law and any applicable provisions of any bond resolution or other instruments governing the fund or funds in which such money is deposited;(h) to exercise the power of eminent domain;(i) to enter into, on it’s own behalf or as agent for any one or more of its Members, any contract or agreement necessary, appropriate or incidental to the effectuation of its lawful purposes and the exercise of the powers granted herein, including, without limitation, contracts or agreements for the purchase, sale, tolling, exchange, energy, and other related attributes from any source, and fuel or any rights thereto of any kind for any such purposes, within and without the Commonwealth of Kentucky, in such amounts as it shall determine to be necessary and appropriate to make the most effective use of its powers and to meet its re-sponsibilities and with such persons or other entities, public or private, on such terms and for such period of time as its Board of Directors or Executive Committee determines; provided, however, that the Agency shall not sell, transfer or distribute any electrical power, capacity, energy or related attributes except on a wholesale basis; (j) to plan, finance, acquire, engineer, design, construct, purchase, operate, maintain, use, share the cost of, own, lease, sell or dispose of any communication, information services, fiber optic and/or telecommunica-tions services project or projects as may be permitted by applicable law and any and all facilities, including all equipment, structures, machinery, and tangible and intangible property, real and personal, convenient or necessary for any such project or projects, whether within or without the Commonwealth of Kentucky;(k) to make and enter into contracts in its own name to employ agents or employees, to acquire, con-struct, lease, rent, manage, maintain or operate buildings, plants, fuel supplies, works or improvements and to acquire, hold or dispose of property;(l) to incur debts, liabilities, or obligations, including but not limited to bank or governmental loans, which do not constitute debts, liabilities or obligations of the Members;(m) to sue and be sued;(n) to exercise any power, privilege or authority which is necessary or desirable to further the purposes of the Agency and which the members might exercise in their individual capacities;(o) to exercise any other power or powers conferred presently or in the future under the laws of Ken-tucky, as are in furtherance of the purposes of the Agency;(p) to establish, operate and manage a pooled purchasing, financing or loan project or projects for utilization by the Agency or one or more of its Members;(q) to procure insurance from such insurers as it deems desirable, to establish self-insurance, to otherwise establish a program or project to provide insurance for the Agency and/or its Members, its officers and direc-tors or any combination thereof to insure against any losses or claims in connection with the activities, property, operations or assets of the Agency, its Members or its officers and directors;(r) to establish energy risk management programs, and acquire and liquidate financial hedging instru-ments and options to stabilize and mitigate risks associated with obtaining and providing electrical capacity and energy and fuel supply, and the financing of Agency activities;(s) to establish prices for sales of energy, capacity, ancillary services or other products and services autho-rized by this Agreement to Members of the Agency and third parties;(t) to establish policies and procedures regarding the governance, financial operations, risk manage-ment, personnel, compensation, benefits and other prudent business matters of the Agency; and/or(u) to undertake or participate in any other lawful activity. Section 3. Implementation of Services with Members. In exercising its powers to provide its Members with various resources, services and/or benefits, the Agency may establish and enter into agreements with one or more of its Members:(a) to provide all requirements power supply services to Members (an “All Requirements Agreement”);(b) to provide a portion of the power and energy requirements of Members (a “Partial Requirements Agreement”);(c) to establish, undertake and provide, from time to time, assistance or services for Members;(d) to purchase energy, capacity and ancillary services for Members (a “Power Purchase Agreement”);(e) to act as agent for Members (an “Agency Agreement”);Nothing in this Section 3 shall be interpreted to limit the powers of the Agency to provide its Members with other resources, services or benefits.

ARTICLE IIIORGANIZATION OF THE AGENCY

Section 1. Board of Directors. The Agency shall be governed by a Board of Directors composed of one Director (the “Director”) designated by the governing body of each Member of the Agency, who shall serve at the pleasure of the Member designation him or her. A Member may designate an alternate Director (the “Alternate Director”) to serve in the absence of its Director. The Alternate Director shall have the power and authority to participate and vote in matters of the Board of Directors or any committee established by the Board of Directors in the absence of the designated Director. The Director and the Alternate Director must each be a member of the governing body or a senior management employee of the Member or the Member’s electrical utility system.

BMU would be only 1 member with only 1 director and only 1 vote

ORDINANCE 08-2015

AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF BEREA, KENTUCKY, APPROVING AN INTERLOCAL COOPERATION AGREEMENT AUTHORIZING THE FORMATION AND THE ESTAB-

LISHMENT OF THE KENTUCKY MUNICIPAL ENERGY AGENCY

Section 1. Creation of Joint Public Agency. That the formation, creation and establishment of a joint public agency pursuant to the Act, to be known as the “Kentucky Municipal Energy Agency”, is hereby autho-rized and approved.

Section 2. Approval of Interlocal Cooperation Agreement. That the proposed Interlocal Coopera-tion Agreement (the “Agreement”), attached to the resolution as Exhibit A, forming, creating and establish-ing the Kentucky Municipal Energy Agency (“KMEA”), having been prepared and tendered to this City, is hereby approved, with such changes, insertions and omissions as the City’s Mayor shall approve, such approval to be conclusively evidenced by the execution of said documents, in order to effectuate the purposes of this Ordinance; and the Mayor and City Clerk are hereby authorized to execute and acknowledge same for and on behalf of the City so that KMEA may constitute a joint public agency of which the City is a member thereof.

Section 3. Appointment of KMEA Representatives. That pursuant to the terms of the Agreement, the City hereby appoints and approves _____________________ as its representative and director to the KMEA Board of Directors and ______________________ as its alternate representative to the KMEA Board of Directors.

Section 4. KMEA Line of Credit. That the City recognizes that KMEA will need to establish credit to begin to operate and to review and initiate projects and coordinated actions for its members (the “Mem-bers”) and hereby requests KMEA to establish a line of credit for its operations and initial activities in an amount not to exceed $5,000,000 (the “Line of Credit”) for the purpose of funding KMEA’s operations, projects and undertakings. The City recognizes and understands that KMEA’s Members, including the City, will be assessed proportionally, from time to time, for the repayment of said Line of Credit all in accordance with the terms of the Agreement and the actions of the KMEA Board.

Section 5. City Officers Authorized to Execute Necessary Documents. That the Mayor, City Clerk and other officers of the City, be and are hereby authorized, on behalf of the City, to execute any and all docu-ments, and to take whatever action, necessary to implement this Ordinance.

Section 6. Effective Date. This Ordinance shall take effect from and after its passage and approval.

Council was asked to approve the above ordinance.

These are reasons I moved to table the ordinance that would include Berea in the proposed Kentucky Municipal Energy Agency.

I have many concerns on the agreement that would make the City of Berea a partner in what has the potential to become a huge liability. We have been asked to agree to something that is all unknowns. We really have no idea of how much this could eventually cost or of how much savings, if any, the city would see.

The KEMA group is taking no risk. They would have a blank check for start up, they are not even able to say how much money they will need. All they seem to know for sure is that they want a five million dollar line of credit, to start.

The federal government has control over federal requirements, the EPA, and other government entities place on power plants. So, no one really has a fixed power cost. I don’t believe there’s anyone who’d be able to say what the costs will be in 2019.

I see this proposal as too risky for the citizens of Berea. We would take on all the risks and unknowns for what MAY BE a small savings somewhere down the road.

I feel good that Berea is financially sound, I want to keep it that way. Think about that five million dollar line of credit, we as a city and any of the others who sign on to this agreement will have to guarantee the loan.

At the time I voted not to renew the contract with KU, I expected that we as a city would go to other power providers including KU and negotiate. I never dreamed somebody would want to start a whole new company, with all the unknowns and try to sell it to us.

After an ordinance is passed we would not be able to walk away from the agree-ment or just say, “We want out,” until all indebtedness and obligations are cleared up. A thing like this is so easy to get in to, getting out could be costly.

MY question: If this was you personally, investing your own money, would you be interested in this deal?

Jerry Little

If saving money was the goal, there was already a nonprofit in place. Amp Ohio with over 40 years in business, 129 members,

all personnel in place to take care of all electric needs for Berea or any other members.

The bottom line is: Over a 5 year period there will be very little difference in the cost of electricity

no matter who sells it to Berea. So why change something that isn’t broken.

Look back over the years, we have enjoyed low cost, reliable service and a good track record.

Portions of the 13 page KMEA agreement

Question: Risk and Reliability, Who Pays Cost if Wrong?

Portions of the Proposed KMEA Ordinance

Question: Risk and Reliability, Who Pays Cost if Wrong?

Foot note: After all that has happened, was it really about getting lower cost, clean energy , etc. for the members

or was it about starting a new agency?I ask this is because of some of the reasons we were told for wanting to start the new Kentucky Municipal Energy Agency (KMEA). 1.) a nonprofit pays no income tax (saves money)2.) buying power in groups (saves money)3.) sharing cost of administration (saves money)4.) sharing cost of consultants and lawyers (saves money)5.) not going it alone gets better terms (saves money)

Berea’s Electric Dilemma

paid for by Berea Councilman Jerry Little

DRIVEWAY GRAVEL haul-ing & spreading. Residential 859-544-7730 35x17p________________________CAREGIVER looking for work. Will sit with elderly in their home. Experienced. 859-358-6699 leave voicemail. 38x2p

CALL BETTY LAMB LYNN 986-9160 for a brochure orAvon products. 8xtfnb

APARTMENT FOR RENT:1 level, 2 BR. Close to Berea College. $450/mo. + dep. 859-200-8319 29xtfnb________________________APARTMENT FOR RENT 1 BR, excellent location. Utilities included, $450/mo. $450 dep. No pets allowed. Washer/dryer hook-up. 859-314-4706. 39x4b

HOUSE FOR RENT: Beau. 3 bed, 1 BA, 1 car gar. beau. lot, hw fl oor, gas furnace, 1032 Ace Dr. $850/mo.; Lg. 2 bed, 1.5 BA townhouse, 100-2 Morning View. $575.; Beau. 2 bed, 2 BA, 1 car gar. All appliances, Duplex 205-1 Elm St. $675/mo. All units have central heat & air. 986-2266. 12xtfnb________________________HOUSE FOR RENT: 3 or 4 BR, 2 BA. 1800 sq. ft. ranch. Appliances furnished. No pets. $950/mo. Ref req. 859-986-3389. 37xtfnb

LOTS FOR RENT: Large RV lots in Pinnacle View. $350/mo. including utilities. Safe & quiet. 859-582-6033 36xtfnb

SPACE FOR RENT: 2200 sq. ft +/- with individual heat pump and electric meter, serving bar with hot and cold water sink and a bathroom. Room space for meetings and/or for storage. Asking $250 a mo. Call 859 200-5610. Ask for Jake. 34xtfnb ________________________COMMERCIAL SPACE: 3000 sq ft. warehouse w/ 2 overhead doors and offi ce space. Close to I-75. Call 859-661-2090. 39xtfnb

LEVI JEANS $29.99, Car-hartt Jeans $26.99- Napier Brothers, 35 Public Square, Lancaster, KY. 6xtfnb________________________WANTED TO BUY: Your Antiques and collectibles. Antique glassware, furniture, quilts, all types of military items, clocks, watches (working or not), coins, and paper money. All types of gold, silver scrap, cast iron banks, toys, lighters, crock jugs, cast iron skillets, marbles, pocket knives, fi shing items, Indian Arrowheads, and much, much more. Also buying partial estates. Over 25 years experience. Call: Clarence Reece at 606-531-0467 43xtfnb

PLAZA DRIVESTORAGE

10x10 $35/mo • 10x20 $60/mo 10x40 $120/mo • 20x40 $180/mo

call/txt 200-7691, 582-4173

Discount if paid yearly.

• APARTMENTS •

Deadline for classified advertising is noon on Tuesday of each week. Classified ads are $6.50 for the first 25

words, and 10 cents for each additional word. Yard sale ads are $6 with a five-item listing.

Thursday, March 3, 2016 page A6

Janet Bowman(859) 302-3123

[email protected]

HOME workis what I do best!

Blakewood/Wiles Apts

2 BR townhouses2 BR one level apts.

For rent w/ $400 dep.

661-3259, 661-2306986-7692, 986-4095

Storage Units Available

____________________

Blakewood Storage

Units for Rent661-3259, 661-2306986-7692, 986-4095

• SERVICES •

• LAND FOR SALE •

• AVON FOR SALE •

AUCTIONThe Irvin Group

Auctioneers • Realtors1-800-237-9734

Lancaster, KY

Shamrock Apts.1 & 2 BR AvailableW/D hook-up, We pay garbage

Adjoining walking track & playground.

Absolutely no pets.1 BR $3152 BR $400

1 year lease, deposit required

986-5644

$825/mo. + $400 dep.Electric, water, sewer, garbage,

cable and internet PAIDOne level 2 BR, 2 BA

Washer & dryer includedCall (859) 986-0175www.RedColtProperties.com

BRYANT’S CROSSINGAPARTMENTS FOR RENT

A P A R T M E N T S_____________________1 BR $475/mo. 2 BR $500/mo., if

you pay gas & elec. $650/mo., all bills paid. $300 dep. No pets. References

& background check required. Shown by appt. only. Hud approved.

Close to college & stores. 32 Mary Street &

31 Hurley Street, BereaCall 200-6874

Autumn Ridge

$650/mo. + $400 dep.Utilities included

One level, 2 BR, 1 BAWasher & Dryer included

Walk-in closetsCall (859) 986-0175www.RedColtProperties.com

ROARING CREEKAPARTMENTS FOR RENT

Luxury Townhouses in the country, located 10 minutes

south of Kroger and 1 mile north of Berea. Rent: $675 Dep.: $675 All utilities paid. Call: (859) 986-2040 (days)

(859) 986-8894 or (859) 661-0036 (nights)

KinglandTownhouse Apts._____

COMMERCIAL PROPERTY1000-3400 sq. ft.

OFFICE & RETAILSPACE AVAILABLE

at Calico Place, Exit 77

Call (859) 985-7077

3.44 acres in Berea city limits

for sale. $50,000.859-986-4095

• HOUSE FOR LEASE •

NEW 3 BR, 2 BA Brick Ranch

(859) 986-0175www.RedColtProperties.com

House for Lease

Storage Space AvailableStorage units available on

North Dogwood Dr. & Layne Ct. Fenced, Gated, & Climate Controlled Units Available

CALL (859) 986-0175SPECIAL ON 5X10’S-$20 per month!

All real estate advertising in

The Berea Citizen is placed in conformity to

equal housing rules.

• LOT •

WILESTrailer Park

SPACE FOR RENT

859 661-3259 859 986-4095

In the Berea and Richmond area

859 661-0036

APTS &

• APARTMENTS •

EQUAL HOUSINGOPPORTUNITY

Jackson Valley Apartmentsis now accepting applications

for 1 BR, 2 BR and 3 BR apartments.

Rent is based on income. Garbage and water included.

On Site laundry and playground area.

Units available for immediate move in upon approval.

Applications may be picked up at the office Monday,

Tuesday, Thursday and Friday.Hours 9 -12 and 1 - 4.

Office closed on Wednesdays1-606-287-7677

TTY 1-800-648-6056Hearing/Speech Impaired only

Call (859) 661-0304 or (859) 625-2528

Check us out atkjcky.com

2 BR / 1 ½ BA Two story Apts. located in the newly developed area of Central Park on Brooklyn Blvd.

Kitchens furnished with all black appliances, including microwave & dishwasher. Utility room has w/d hook up and ½ bath.Nice size rooms with lots

of closet space. These are a must see! $750 Rent utilities included / $500 deposit. 1 year lease.

Davis$20 - $60859-582-9710Hwy. 21 West

115 Linda Ln.

Storage Units

BRTODD INVESTMENTS

$700 per monthAppliances &

utilities included

2 BR Apartments

(859) 661-2950

• COMMERCIAL •

• HOUSE FOR RENT •

Locust Hill Apts 105 Lewis St. Berea

2 BR, single level, w/d hook-up, No pets. $500/mo. + utilities

$500 dep. 1 year lease. Call (859) 625-2760 after 3 p.m.

• MISCELLANEOUS •

ClassifiedA7 The Berea Citizen Thursday, March 3, 2016

FOR SALE

112 Bryon Avenue • Berea112 Bryon Avenue • Berea

New Kitchen in 2014

www.timothypack.com/112Bryon

859.625.4824

Suncrest Meadows

• 3 Large BR, 2.5 BA • 2,136 sq.ft. • Walk-out Basement (100% Dry)• New Roof• 2-Car Garage (Door new 2014)• 2014 Kitchen• A LOT of Storage

• Studio/O� ce (in basement) • Workshop/Tool Room • Gas Fireplace• Mad.Co./Berea Schools• Suncrest Meadows Subd.• Master Bath Skylite• Only $167,000

GILLIAMREAL ESTATE & AUCTION

John W. Gilliam Principal Broker/Auctioneer

Loretta PowellRealtor/fulltime agent

(859) 986-9417home

(859) 302-8411mobile

www.gilliamrealestate.com

(859) 986-9797

427 Chestnut Street, Berea, KY

• 200 GINGER DRIVE - (42.67 ACRES) ................................................................PENDING $149,000• 1794 CAlICo RD. (50 ACRES +/-) ...........................................................................SOLD $110,000• RENFRo VAllEY - 11 ACRES ....................................................................................................$50,000• PEGGY FlATS RD. - CoMMERCIAl - EXIT 77 ............................... $500,000. owNER/bRokER

LAND

• 104 wooDS TRAIl | RIChMoND (DUPlEX) ........................REDUCED $159,900• 962 bARkER lN. wEST... ...................................................................SOLD $229,900• 137 CRoSSING VIEw DR. ............................................................... SOLD $119,900• 911 GREENwooD DR... ......................................................................SOLD $169,900• 124 CENTRAl AVE. (DUPlEX) ......................................................... SOLD $89,900• 128 CENTRAl AVE. (DUPlEX) ......................................................... SOLD $89,900• 262 ShoRT lINE Pk. (15.25 ACRES) .......................................REDUCED $160,000• 270 wIllIAMS ST. (MT. VERNoN CoMMERCIAl) .......... REDUCED $69,900• 211 GlADES ST. ....................................................................................SOLD $121,900• 446 ChRISTMAS RIDGE RD. .............................................................SOLD $125,000• 420 PlUMTREE DR. (NEw ShINGlES) ...................................................... $127,900• 2800 RIChMoND ST. (RENFRo VAllEY) 1A. ......................REDUCED $119,000• 2780 RIChMoND ST. (RENFRo VAllEY) ............................. REDUCED $70,000

Love coming home to this magnificent log residence on 12.02 splendid woodland Ac. It’s waiting for you to complete the picture! The 2-sty stone FP creates the perfect centerpiece for the 1st flr open living area. Palladium style windows flood the GR with sunlight & seasonal views of surrounding forest. HW, tile, granite countertops, stainless app., Jacuzzi tub& sep. tile shwr in MBath. Ext. living space-decks & new kit.w/BI grill, patio w/stone firepit invite you to spend time relaxing outdoors-geat for entertaining. Acreage allows space to hunt, 4-wheel, enjoy nature. Must see to appreciate!

NEW LISTING

3006 Noble Ct. waco MlS#54191 $390,000

623 CHESTNUT STREET • BEREANEW LISTING

This home has been completely remodeled and is absolutely gorgeous! Beautiful crown molding to accentuate the tall ceilings and classic wooden staircase. The living room fireplace gives a nice, cozy feel to this historic type home. Nice laminate wood flooring and ceramic tile, brand new thermal insulated windows throughout, new heat/air unit, large closets, full basement with outside entrance. Nice level lot, partially fenced with brand new roof. Large storage building with fall out storm shelter under ground. Located in beautiful downtown Berea, walking distance to Berea College. $110,000. MLS#53775

107 North Killarney, Richmond(859) 624-1782

Agent Email: [email protected]

HOSTED BYStephanie Hembree

(859) 314-4706

711 Chestnut Street • Berea • 986-8401

KRISTIE FAIN582-6502

[email protected]

140 Tremont Drive • Tremont Subdivision4 BR, 3 BA, Full finished walk-out basement

Beautifully maintained home minutes to I-75 in the desirable Tremont Subdivision. Two master suites, two kitchens, formal dining room, and sunroom built for hosting a large family or entertaining guests. Covered porches and a covered patio overlook a stunning tree lined acre lot. The seller is offering a $5,000 flooring allowance with the closing of the home. MLS#53250 $229,000 Call Kristie Fain 859-582-6502

Foster, Realtors®

OPEN HOUSE • SUNDAY 2 - 4OPEN HOUSE SUN 2-41007 Burnell Drive

(Homestead - Berea)

Brand new 3 BR, 2 BA all brick ranch in city limits in a great neighborhood. Engineered hardwood floors in living room, kitchen & dining area. Gorgeous custom cabinets with stainless appliances & an island. Huge living room with cathedral ceiling. Trey Ceiling & walk-in closet in master! Master with separate tub,

2 sinks & tile shower! Covered back porch backing up to the woods! $169,900Amanda Hembree Principal Broker/Owner

634 Chestnut Street • Berea, KY 40403 859-624-2060330 Eastern Bypass Ste. 2 • Richmond, KY 40475

(859) 986-3389 • (606) 256-5204www.roytoddbuilders.com

• Ready for VA/FHA 2/10 warranty• New homes for sale • 100% Financing

COMMERCIAL LOTS - GLADES ROAD

RETAIL / PROFESSIONAL SPACE AVAILABLE ON GLADES RD.& PLAZA DRIVE (next to interstate)

ALSO AVAILABLE...

NEW HOMES UNDER CONSTRUCTIONPRICES STARTING AT $129,900

Eagle Point Subdivision 4 BR, 3 BA, 2,400 sq. ft. total, $154,900.

Eagle Drive (Beside Roundstone School) Brand New 12 Acres, 4 BR, 3 BA, 2,400 sq. ft. total, $159,900.

Hemlock Circle (Mount Vernon) 1,320 sq. ft., 3 BR, 2 BA, 1 Car Garage, $139,900.

152 Old US 25 (Across from Silver Creek School) 1,500 sq. ft., 3 BR, 2 1/2 BA, 1 Car Garage, $144,900.

• Energy Efficient

Sugarville Meadows Off Hwy. 1016. 3BR, 2 1/2 BA, 2 story, 1 Car Garage, 2000 square feet, energy efficient. $144,900.

Now Available 3 BR, 2 BA, 2 car garage, covered front and back porches, tray ceilings throughout. $144,900.

Please visit our website for all our listings www.BHHSfosterrealtors.com

ASSOCIATES• Phil Malicote, GRI ...................................582-8882• Janet Bowman ........................................302-3123• Steve Clark .............................................625-4370• Kathy Clark .............................................625-4307• Keith Johns ............................................625-4117• Kristie Fain .............................................582-6502• Sune Frederiksen ...................................248-0690

www.BHHSfosterrealtors.comemail: [email protected]

711 Chestnut Street, BereaOffice Hours: Mon-Fri 9-5; Sat and Sun by appt.

859-986-84011-800-998-2063 • fax 986-6173

FosterRealtors®

©2014 BHH Affiliates, LLC. An independently owned and operated franchisee of BHH Affiliates, LLC. Berkshire Hathaway HomeServices and the Berkshire Hathaway HomeServices symbol are registered service marks of HomeServices of America, Inc.® Equal Housing Opportunity.

140 TREMONT DR. 4 BR, 3 BA full finished walkout basement 2 kitchens 1 acre $229,000 MLS#53250 Kristie Fain 582-6502 320 PINE STREET 3 BR, 1 BA, 2 1/2 BA $129,500 MLS#53192 Phil Malicote 582-8882 114/116 BAUGH ST. PENDING $79,900 MLS#52567 Phil Malicote 582-8882 119 LYNNE DR. New Construction 3 BR, 2 BA $196,900 MLS#53171 Phil Malicote 582-8882 1334 SCAFFOLD CANE RD. SOLD MLS#53036 Janet Bowman 302-3123 138 LORRAINE COURT (Duplex) $92,500 MLS#53010 Phil Malicote 582-8882633 KING LUKE CT. (Kings Trace) 5 BR, 3.5 BA 1 acre $229,900 MLS#51812 Janet Bowman 302-3123645 WOODSIDE WALK (Condo) 2 bdrms, 2 bths $116,000 MLS#51922 Connie Lawson: 661-0285BOX 451 RT. PENDING MLS#51191 Janet Bowman: 302-3123 914 BIG HILL Rd Mt. Vernon 4 BR, 2 BA, fenced back yard 1 1/2 acre $75,000 MLS#50950 Janet Bowman 302-3123 79 CENTRAL AVE. 2 bdrm, 1 bth $59,000 MLS#50551 Phil Malicote 582-8882

Lots • Acreage • Farms

INTERESTED IN A CAREER IN REAL ESTATE? CALL OUR OFFICE FOR

DETAILS! 859/986-8401

208 PEACHBLOOM HILL PENDING $138,500 MLS#54061 Phil Malicote: 582-8882 100 COLLINS DR. - PENDING $192,000, MLS#54093 Keith Johns 625-4117616 C. VALLEY DRIVE 3 BR, 3 1/2 BA Log Home 40 acres $325,000 MLS#53952 Janet Bowman: 302-3123 182 E. HAITI RD. 3 BR, 2 BA, Basement style apartment. A must see. $99,900 MLS#53922 Lisa Foster: 582-1010 1050 FREEDOM SCHOOL RD. Mount Vernon 3 BR, 2 BA Doublewide on 1/2 acre lot. $59,000 MLS#53836 Don Foster: 582-1100 212 ADAMS STREET 2 BR, 1 BA Located in Artist Area Old Town Berea. Garage/Workshop $59,000 MLS#53767 Sune Frederiksen: 248-0690 1019 HONEYSUCKLE COURT 3 BR, 2 BA, 1 Acre $125,000 MLS#53735 Phil Malicote: 582-8882 726/728 O’POSSUM KINGDOM ROAD 2 BR (possible 3rd), 1 BA Recently remodeled 2.5 acres with barn, storage shed. Includes a 1,936 sq. ft. commercial bldg. currently being used as body shop with ef-ficiency apartment. $179,900 MLS#53707 Phil Malicote: 582-8882 120 N. BROADWAY STREET Historic City Jail & extra lot. Totally Updated. Great for Retail or Office. $155,000 MLS#53663 Phil Malicote: 582-8882 110 PARSONS LANE (Mt. Vernon) PENDING MLS#53505 Janet Bowman 302-3123 126 MEADOWLARK DR. 3 BR, 1 BA, $84,999 MLS#53408 Candi Vester 224-6550, Amanda Hill 661-0460255 HERNDON LANE 7 BR, 5 BA 5.218 acres 7,832 sq.ft. $625,000 MLS#53222 Janet Bowman 302-3123

106 EXETER AVE. $27,500 Middlesboro Janet Bowman 302-3123294 DOGWOOD DR. - 0.49 Comm. Lot $100,000 MLS#52820 Candi & Amanda 224-6550 or 661-04601 PAINT LICK RD. - 6.13 Comm. Land. $1,500,000 MLS#53821 Candi & Amanda 224-6550 or 661-04601 DOGWOOD DR. - 8.51 Comm. Land $2,100,000 MLS#53822 Candi & Amanda 224-6550 or 661-0460FARM/ 2325 PEGGY FLATS RD. 182.56 acres prime farm land located 2.3 mi. from I-75. Completely fenced, 3 ponds, gently rolling. $912,500 MLS#53761 Phil Malicote: 582-8882 FARM/ 405 LOCUST BRANCH ROAD 543 acre farm, 200 year updated log home, plus modern 6 year old home. 3 barns, 2 machine sheds. Stocked pond. Guest cottage $1,200,000 MLS#53543 Phil Malicote 582-8882FARM/ 1775 GUYNN RD. 120.55 acres located within 3 mi. of I-75 & Berea.Barns, ponds, pasture, tillable land, woods & wildlife $350,000 MLS#53401 Phil Malicote 582-8882 BREEZY HOLLOW RD. 7.98 acres cleared land. Several bldg sites. $32,000 MLS#53517 Phil Malicote 582-8882 412 RICHMOND RD. - Comm. Lot. $49,900. MLS#48778. Phil Malicote 582-8882.

140 Tremont Drive(Tremont Subdivision)

4 BR, 3 BA, Full finished walk-out basement

MLS#53250 $229,000Hostess:

Kristie Fain: 582-6502

5115 Walnut Meadow Rd.1 1/2 Story, 5 BR, 3 1/2 BA,

1 acre lot. Finished 2nd Floor with plenty of room for 2 additional bedrooms if needed $269,000

MLS#54184Phil Malicote: 582-8882

OPENHOUSE

Sun. Mar. 62-4 pm

NEWLISTING

ADAMS & ASSOCIATES859-623-1900

632 Chestnut Street, Berea, KY 40403 www.realtyworldadams.com

REALTY WORLD®

TM

East Side Avenue Lots$399,900 MLS#53506120 Lynn Drive Berea $19,900 MLS#534121016 Brooklyn Blvd. $32,500 MLS#53411

204/206 Water Street Richmond $120,000 MLS#5334452.4 acres in Walker Branch Subd. $550,000 MLS#53287

Walnut Meadow Rd. Mad.Co.SE $159,900 MLS#515331721 Red Lick Rd. 145 +/- acres $183,300 MLS#49978 Copper Creek Rd. $225,000 MLS#48126 138 acres

Farms / Acreage/ Lots / Commercial

Berea & Richmond

TO SEE OUR OTHER LISTINGS, LOOK US UP ON OUR WEBSITE OR CALL

ONE OF OUR AGENTS!

Kim GipsonRealtor

859-200-1864

Sandy AdamsBroker/Owner

859-623-1900

Bill AdamsRealtor/Owner

859-623-1900

Brad WarfordRealtor/Office Mgr.859-582-7757

Kassy BlethenRealtor

859-779-9935

Paul HobbsRealtor

859-979-3040

Jason WilsonRealtor

859-358-3016

Aundrea DamrellAssoc. Broker859-661-3967

Marilyn StatonRealtor

859-625-2066

David PenningtonRealtor

859-358-6083

Nadine AllmondAssoc. Broker 859-661-5577

Paula MooreRealtor

859-358-4481

Donna MabesRealtor

859-868-8847

Kenny HowellRealtor

859-979-0462

Everett BallardRealtor

859-302-2762

Nathan HackRealtor

859-351-9303

•1103RaceSt.Richmond$39,900MLS#52440

•1032BurnellDr.Berea$174,900MLS#53954

•1417LindenSt.Richmond$64,250MLS#53422

•164PrimroseCircleRichmond$152,000MLS#53917

•51FirstSt.$139,900MLS#53743

•826Riney-BDriveMad.Co.NE$149,000MLS#53841

•793ScaffoldCaneRd.Berea$64,900MLS#53782

•1540MoberlyRd.Mad.Co.NE$52,500MLS#53658

•210LauraDr.Berea$99,900MLS#53567

•939CobbleDr.Richmond$159,900MLS#53615

•179ChristiDr.Mad.Co.SE$169,900MLS#53565

•120CassiusCt.Rd.Berea$124,900MLS#53605

•410KoaCt.Berea$234,000MLS#53537


•122BluebirdAve.Berea$149,900MLS#53554

•100OverlandDr.Richmond$119,900MLS#53448

•202DaiseyRd.Mad.Co.SE$99,900MLS#53416

•210BooneSt.Berea$21,000MLS#53376

•1006IdylwildCt.Mad.Co.SW$199,900MLS#53336

•2542PaintLickRd.Mad.Co.SE$169,900MLS#53355

•317WilsonLn.Mad.Co.SE$129,900MLS#53226

•116St.Anne’sCt.MadCo.NW$385,000MLS#53162

•112GladesSt.Berea$92,500MLS#53054

•541SagemontDr.Richmond$154,900MLS#52860

•359PeachtreeDr.Berea$129,900MLS#52587

•1167BlueLickRd.Mad.Co.SW$127,900MLS#52546

•430CedarCliffRd.Mad.Co.SE$219,900MLS#52217

•1037BurnellDr.Mad.Co.SE$245,000MLS#49630

•1448Jack’sCreekRd.$239,900MLS#52541

•105ClayDriveRichmond$124,900MLS#51946

•254LombardyDrive$169,900MLS#51951

•545PhelpsRoad$89,500MLS#51870

NEW LISTING

660 CollegeHill Road

Waco$57,000

MLS#54152

NEWSee All Our Listings

atwww.realtyworldadams.com

RN for Hospice Care Plus, Admissions NurseFull time with excellent benefits including 31 days of paid time off per year. Must be available to work til 8:00 pm, eight or ten hour shifts available. Graduate of accredited school of nurs-ing, Ky. RN license and one year of experience required. For more information call 859-986-1500 Sue Lunsford, HR Coordinator or send resume to [email protected]. EOE.

Qualifications

Full time Auto Body Tech needed for a very busy high quality collision repair facility.

Monday - Friday 8:00-5:00

Qualifications• Examines damaged vehicle and efficiently plan

repair process• Ability to use frame machine• Certification in body repair preferred• Knowledge of vehicle repair process by

manufacturer• I-CAR welding certified• Skill in analyzing and interpreting measuring data• 10 years or more experience• Looking for someone that is able to turn 60 plus

hours per week

We offer medical and dental insurance.Competitive pay based upon experience

PLEASE RESPOND WITH RESUME

Full time Auto Body Tech needed for a very busy high quality collision repair facility.

Monday - Friday 8:00-5:00

Qualifications• Examines damaged vehicle and efficiently plan

repair process• Ability to use frame machine• Certification in body repair preferred• Knowledge of vehicle repair process by

manufacturer• I-CAR welding certified• Skill in analyzing and interpreting measuring data• 10 years or more experience• Looking for someone that is able to turn 60 plus

hours per week

We offer medical and dental insurance.Competitive pay based upon experience

PLEASE RESPOND WITH RESUME

contact • 859 986-8611 •[email protected]


Date: 3/1 /2016 to 03/01/2018Below is the recently approved price structure for all residential and commercial waste and recycling collection services within the City of Berea for the period of 3/1/16 to 3/1/2018. Please contact us with any questions about your service at the numbers listed below. Thank you for the opportunity to serve your community for another two years.

1.0 Residential Waste Collection A. Collection Class Monthly Fee Quarterly Fee Curbside Garbage Collection (10 Bag limit) $9.30 $27.90 Backdoor Garbage Collection (10 bag limit) $16.50 $49.50 Handicapped Garbage Collection (10 Bag limit) $11.00 $33.00 Waste Wheeler Rental $2.00 $6.00 Extra Bag Charge* $0.90 $0.90 * For residential and small business customers only. Per Bag Per Bag ** Rates for residential garbage collection shown above include the monthly, recycling fee. Bulk Items Per Item Per Item Appliances (White Goods) $14.00 $14.00 Stuffed Chairs $8.50 $8.50 Couches & Loveseats $14.00 $14.00 Non-Stuffed Chairs $7.00 $7.00 Carpeting (per room) $12.00 $12.00 Fencing & Wire (per foot) $2.25 $2.25 1.1 Commercial Waste Collection A. Collection Class Monthly Fee Quarterly Fee Small Business 4 cans 1x week $14.30 $42.90 4 cans 2x week $27.50 $82.50 4 cans 3x week $39.05 $117.15 4 cans 4x week $52.80 $158.40 4 cans 5x week $65.75 $197.25 4 cans 6x week $78.95 $236.85 Business Waste Wheeler Rental $3.00 $9.00 *Rates for small business garbage collection shown above include the monthly, recycling fee. **Rates shown below next to the number of pick ups per week/month shall include the costs of collection and disposal only. Rental costs are shown separately. Large Business Size - 3 cu. yd. Monthly Fee Quarterly Fee 1x per week $47.87 $143.61 2x per week $95.73 $287.19 3x per week $143.61 $430.83 4x per week $191.48 $574.44 5x per week $239.34 $718.02 6x per week $287.21 $861.63 2x per month $23.94 $71.82 Rental on container $11.00 $33.00 Extra pickups $23.94 each $23.94 each Size - 4 cu. yd. Monthly Fee Quarterly Fee 1x per week $57.16 $171.48 2x per week $114.31 $342.93 3x per week $171.47 $514.41 4x per week $228.62 $685.86 5x per week $285.78 $857.34 6x per week $342.94 $1,028.82 2x per month $28.58 $85.74 Rental on container $13.75 $41.25 Extra pickups $28.58 each $28.58 each Size - 6 cu. yd. Monthly Fee Quarterly Fee 1x per week $78.60 $235.80 2x per week $157.18 $471.54 3x per week $235.77 $707.31 4x per week $314.36 $943.08 5x per week $392.95 $1,178.85 6x per week $471.54 $1,414.62 2x per month $39.29 $117.87 Rental on container $16.04 $48.12 Extra pickups $39.29 each $39.29 each Size - 8 cu. yd. Monthly Fee Quarterly Fee 1x per week $95.26 $285.78 2x per week $190.52 $571.56 3x per week $285.78 $857.34 4x per week $381.04 $1,143.12

5x per week $476.30 $1,428.90 6x per week $571.56 $1,714.68 2x per month N/A Rental on container $17.41 $52.23 Extra pickups $48.73 each $48.73 each Chains only $35.24 $105.73 Chains and lock $42.30 $126.89 1.2 Other Service A. Commercial Recycling Containers (Front loading containers optional. See section II (3.6) of the initial bid proposal for list of Commercial recycling). Size - 4 cu. yd. Monthly Fee Quarterly Fee 1x per week $49.53 $148.59 2x per week $99.07 $297.21 2x per month $27.78 $83.34 6 cu. yd. container Monthly Fee Quarterly Fee 1x per week $68.59 $205.77 2x per week $137.17 $411.51 2x per month $34.30 $102.90 8 cu. yd. Monthly Fee Quarterly Fee 1x per week $87.64 $262.92 2x per week $175.27 $525.81 2x per month $43.82 $131.46 B. Residential Dumpsters 6 cu. yd. rear loader Delivery charge (includes one week’s rent) $48.00 Empty Charge $27.50 Additional week’s rental $13.00 C. Construction Site Dumpsters

Delivery Charge $82.50 Hauling Charge $275.00 Disposal Charge $30.00 Lease Charge:

20 cu. yd. $3.30 per day 30 cu. yd. $4.40 per day 40 cu. yd. $5.50 per day

D. Convenience Center (Delivery by customer) White goods $15.00 each Stuffed Chairs $10.00 each Couches and Love Seats $10.00 eachNon-stuffed chairs $5.00 each King Size Mattress $15.00 each All other Mattresses $10.00 each Box Springs $5.00 each E. Non-specified material (other than above) Household Construction Small Pickup truck $15.00 $25.00 Full Size Pickup truck $25.00 $35.00 Smal Dump trailer/Truck $40.00 $50.00 Medium Dump Trailer/Truck $50.00 $60.00 Large Dump Trailer/Truck $60.00 $75.00 Small Flatbed Trailer $10.00 $20.00 Large Flatbed Trailer $25.00 $40.00 Multi-axel Dump Trailer/Truck $110.00 $150.00 F. Shingle (pricing can vary due to overloaded vehicles) Pickup Truck $50.00 Dump Trailer Single Axel $75.00 Large Dump Trailer Multi Axle $150.00 Dump Truck $200.00

RENEWAL PRICE LIST

Commercial & Rolloff Services Residential and Single Family Service From: WCI of Kentucky Inc. From: Poff Carting Address: P.O. Box 808 Address: P.O. Box 200 Lily, Kentucky 40740 Pittsburg, KY 40755 Telephone Number: 1-866-428-4208 Telephone Number: 1-877-288-2981

SOUTHERN MADISON WATER DISTRICTPUBLIC NOTICEEffective March 15, 2016

Southern Madison Water District’s Board of Commissioners monthly meeting will be held the

third Tuesday of each month at 207 N. Dogwood Drive, Berea, KY at 7:00 pm (859) 986-0373

• ROLLBACK • 4X4 DUAL LINE RECOVERY WRECKER

•LIGHT DUTY CHEVY WRECKER. FULLY INSURED AND LICENSED & AAA CERTIFIED.ROADSIDE ASSISTANCE INCLUDING UNLOCKS AND

WINCH OUT SERVICES 24 HOURS A DAY.

859 200-2090

Most inquiries about Berea’s business community begin with the Berea Chamber of Commerce,

275 businesses strong and growing.

Our Chamber members enjoy: “Working Together for a Better Berea”

More Information

As a business owner, you do not have time to attend all of the public meetings and follow local, state and federal issues. Chamber mem-bership allows you to focus on your business while we work with local governments to represent the needs of our business community.

Our website provides information to the world 24/7. We conduct annual Legislative Trips to Frankfort to meet with our legislators and dem-onstrate how our state government works. We also promote regional workshops and seminars to allow you and your employees to learn about specific topics and issues.

More Business

Through the telephone, walk-in and internet inquiries, the Berea Cham-ber of Commerce takes great pride in referring our members. Much like the Better Business Bureau’s logo, prospective customers seek out the Chamber logos / window clings that are placed on the doors and windows of our Chamber members as a sign of a reputable business.

We offer referral services, an on-line business directory, member to member discounts and advertising opportunities for all budgets.

More Exposure

Exposure comes naturally when you are a member of the Berea Chamber of Commerce. Take full advantage of free publicity most businesses cannot afford.

We offer new member recognition, FREE ribbon cutting services, website links and numerous net-working events.

Join the Chamber

Today!

More Connections

Our Chamber members have a better connection to the commu-nity because they are connected to each other. In addition to our monthly newsletter and member-ship meetings, our Chamber members receive timely communi-cations through our email distribu-tion lists two and three times per week.

Your circle of influence is 275 businesses strong. Collectively we can accomplish things that we could not consider as a small busi-ness owner.

Join us for New Member Orienta-tion Sessions, Speed Networking, committee work and monthly membership meetings.

Apply on-line at www.BereaChamber.com or call 859-986-9760 to request an application. www.BereaChamber.com

A9 The Berea Citizen Local News Thursday, March 3, 2016

the


BereaContact us:

[email protected]

In Person:711 Chestnut Street

Suite 2

By Mail:P.O. Box 207

Berea, KY 40403

By Phone:859.986.0959

By Fax:859.986.0960

The Berea Citizen,Always Local Always There

Police Reports from 2/26/16 - 2/29/16

Theft• On February 26, a resi-dent from the 1000 block of Brooklyn Blvd reported that a cell phone was sto-len. The estimated loss was $50.

Burglary• On February 27, a resi-dent from the 100 block of Joshua Circle reported

items stolen from inside of his residence. The esti-mated loss was $1, 541.

Public Intoxication• On February 29, officers were called to the Berea Skate Park because of a man who was possibly under the influence. The man was unsteady on his feet, and was stumbling around.

Officers arrested Brian Hatcher, 32, of Berea and charged him with public

intoxication. • On February 29, officers were called to Brooklyn Blvd because of an intoxi-cated man lying on the ground. The man was yelling and screaming when officers arrived, and had been yelling at chil-dren in the neighborhood.

Officers arrested Da-vid Snyder, 33, of Mount Vernon and charged him with public intoxication and second degree disor-derly conduct.

B E R E A P O L I C E R E P O R T S

In service to bereaSpotlight on Local First Responders

Meet Jared Rigsby, a fire-fighter on C Shift with the

Berea Fire Department.

When did you first consid-er becoming a firefighter? What drew you to the profession? I have always thought about firefight-ing growing up around the fire house. But I would say I started to seriously consider

it during my second year in college when I switched my major to fire science.

What is the most reward-ing part of being a fire-fighter? Getting to help and serve the community where I was born and raised. Berea being a small town, you can actually see the difference you are making every day.

What is the strangest sit-uation you’ve ever faced in your job? Responded to a structure fire on Big Hill Road. The guy was trying to light his fireplace with gas. There was a small explosion that caught the dog on fire, who ran to the back bed-room and caught that end of the house on fire. The dog survived.

Tell us about your family. I’m married, and my wife, Al-lie, is a paramedic at Madi-son County EMS. I have a three-year-old son, Parker. My father retired as chief at Berea Fire Department in 2009.

What is difficult about being a firefighter? For me, it’s being away from my family every third day. Every third day doesn’t sound that bad until you’ve done it for a couple of years and you see how much you can truly miss.

Tell us something that most people wouldn’t know about you. I like to go rock climbing, and I’m learning to play the piano.

the quality of the water in Berea, because of the situa-tion in Flint, Michigan. He spoke to Ed Fortner, the director of the Berea Mu-nicipal Utilities (BMU), who reported that BMU is in compliance with all EPA and Kentucky Divi-sion of Water regulations, including lead and cop-per.

“BMU is actually un-der ‘reduced monitor-ing’ status with the rule,” Fortner reported, because of past testing results, where BMU’s water were well below the allowed lead limit of 0.015 mg/L. BMU’s water came in at 0.002 mg/L.

Fortner wrote that resi-dents were welcome to re-view the annual Consum-er Confidence Report that details the results of the water quality monitoring. The report is available at BMU’s office on Harrison

Road, and on the website.Todd Ritter from the Di-

vision of Water also sent a letter, confirming that BMU has not exceeded the lead and copper action levels for the 2015 moni-toring period.

In other business:• The Berea City

Council approved a resolution to accept the $500,000 CDBG (Commu-nity Development Block Grant) for the renova-tion and construction of the Berea Fire Station on Chestnut Street.

• The City of Berea met with Madison Coun-ty Fiscal Court to discuss work on the state roads that are within city limits. It was decided that the county would be respon-sible for secondary state roads within Berea, such as Highway 595 or 1016. The state would be re-sponsible for Highway 21 and Highway 25 within the City of Berea.

• Connelly signed a proclamation recogniz-ing the achievements of

the Madison Southern High School cheerlead-ers, who placed second in the Large Varsity Division II competition in Florida, the highest a team from Madison County has ever placed at the varsity level.

• City Council heard the first reading of the updated ordinance regulating alcohol sales within the City of Berea. The state requested that they carefully define “open bar,” which is pro-hibited within Berea’s or-dinance. The ordinance now states that, “any area for serving alcohol must be operated in connection with a restaurant . . . must be directly connected with a dining room and must be only a service area for patrons of the restaurant.” An open bar is “a bar with unlimited alcohol sales; a facility that sells alcohol without food; or not pur-chased “in conjunction with a meal.”

• Council heard the first reading of the amended 2015-16 budget.

APPCONTINUED FROM PAGE A1

ing Stepping Out for Art. “I want to thank Deborah Hille. About this time last year, she proposed creat-ing the awards and helped to develop the criteria and the process.”

Culbreth, who created the Berea Christmas Pa-rade, Walk with the Arts, and the Red Lick Valley Artisan Studio Tour, re-ceived a standing ovation when she was announced the Artist of the Year. Crite-ria for the award included devoting time to practice and/or perform one or more art disciplines, en-hancing their own skills and professional develop-ment, promoting of them-selves as an artist, and impacting the Berea com-munity in a positive man-ner.

“The list of ways our community has benefited from the energy and cre-ativity of our winner is a long one,” Childs said, be-fore introducing Culbreth as the winner.

Along with creating the Christmas parade and Walk with the Arts, Cul-breth served on the board of the Kentucky Guild of Artists and Craftsmen, taught children and adults in art workshops, and con-tinues to volunteer for dif-ferent events around the community.

Jonathan Clark, a local painter, said of Culbreth, “She should probably get Artist of the Year every year.”

The Community Arts Award winner, Bolin, founded the Berea Arts Council, and served as a board member from 1986 – 1993. A faculty member of Berea College from 1970 – 2009, Bolin directed over 50 plays for Berea College students and community members, and served on the Kentucky Humanities Council as well as Berea Community school board.

Before giving Bolin his award, Childs reported that Bolin led the commit-tee that eventually created the Berea Arts Council. She quotes one member of that committee as saying, “he was the mover and shaker behind all that the group

accomplished. He led the meetings and did much of the ground work to gather information that was perti-nent to creating the Berea Arts Council.”

There was a sold-out crowd at Stepping Out for Art, which took place at the old Churchill Weav-ers building. In honor of the Looking Glass theme, staff and board members dressed up with tea cup hats, and many sported Mad Hatter outfits.

Childs reported that Berea Arts Council made more money off the art auction than last year; the items were all donated by artists that support the or-ganization.

“Some groups start be-cause a few people have a shared interest, but they fold when those people move on to other activi-ties,” Childs said in her remarks before award-ing Bolin. “The successful ones, the ones that remain relevant for decades, con-tinue because the organiz-ers have a clear purpose, act to benefit their com-munity, and can attract like-minded members who keep it growing.”

ARTSCONTINUED FROM PAGE A1

have been joined this year with seventh graders Trinity Strong and Kaylee Kapp, and eighth grader, Kyleigh Jackson.

Tate sent in seven audi-tions from her choir stu-dents, and the above six students were selected.

There were 1,200 audi-tions total sent in from schools across Kentucky, and only 200 were select-ed for the All-State Choir. The students selected for the All-State Choir, in-cluding the six Farristown students, performed at the KMEA (Kentucky Mu-sic Educators Association) conference on February 4 in Louisville.

Kyleigh, Trinity and Kaylee described the ex-perience of performing with the most talented young singers in Ken-tucky as “overwhelming, but in a good way.”

“You connect to people

with your voice,” Trinity said.

The process of perform-ing at the KMEA confer-ence is a grueling one, with the 200 students cramming rehearsals in for two days before the performance. The choirs perform five songs each. The music is sent to the All-State students ahead of time, so they can pre-pare for the performance, but this year the music was sent after Christmas break.

“Last year I practiced during Christmas break,” Andrew said, “but this year I couldn’t because we hadn’t received the music yet.”

Andrew had a particu-larly difficult assignment, in his participation with the mixed chorus. They had to learn one African tune in the native lan-guage, so it was chal-lenging to work on the pronunciation as well as the music. The music the students performed at KMEA was a mix of spiri-

tual, contemporary, fes-tival, and other musical genres.

The audition tapes were sent in last October, so the Farristown students had to wait a few months to see if they were chosen for the All-State choir. One of them groaned that it was, “forever! We had to wait forever!” to find out if they would indeed be one of the 200 selected.

All six of the Farristown singers plan to continue their work in music, and a few of the eighth graders are interested in pursu-ing drama as well when they graduate to Madison Southern. Then they can audition for the musicals at the school, they said.

Serenity and Trinity also play piano, and for Seren-ity that is as big a passion as singing.

“It was such a great ex-perience,” Erica said, with the fervent agreement of her fellow Farristown singers.

SINGERSCONTINUED FROM PAGE A1

of their house, and the wholesale bakery sells products through stores, restaurants and farmer’s markets. They have cre-ated a successful business doing something they love that provides their liveli-hood.

Their story reflects a cur-rent trend in American employment, according to Peter Hackbert of the Entrepreneurship for the Common Good program at Berea College.

“We are becoming inde-pendent businesses and not dependent on an em-ployer,” Hackbert said.

People create freelance businesses by sharing their marketable skills.

Hackbert points out an-other local model of this

type of entrepreneurship: the mini mall/antique store containing separate booths. Berea has at least five such establishments.

“We know that 25% of people in Berea are under the poverty line. Every one of the people that rents a booth is an entrepreneur, and this kind of ‘survival’ entrepreneur provides an important revenue stream for the household,” Hack-bert said.

Hackbert sees lots of po-tential for these freelance businesses in Berea. The Arts Accelerator program model, where freelanc-ers share space, could be expanded for a variety of businesses. One example is a place for knowledge workers like accountants, web developers, writers, and graphic designers. Be-sides offering support and saving money by sharing resources, they could work with each other on ideas

and jobs.There are some prin-

ciples echoed by Elliott, Windland, Hackbert, and other experts in business development that provide a window into how these businesses could rise up in Berea.

One characteristic of these freelance businesses is that they follow an or-ganic growth pattern. Cle-mentine’s began by baking in a home kitchen and sell-ing at farmer’s markets, and has expanded gradu-ally through the help of a Kentucky State University small producer grant and a loan to add a certified kitchen.

This growth pattern is echoed in a new feasibil-ity study for the Berea Farmer’s Market, an outlet for many local freelancers. Nathan Routt of the Ken-tucky Center for Agricul-ture and Rural Develop-ment concluded that the

market is currently ready for a permanent location with a covered pavilion. There is also potential for the market to grow to in-clude into a year-round re-tail space with cold storage and a commercial kitchen, over time and in response to customer demand.

These freelance business-es also are more dependent on partnerships than com-petition for their success.

Elliott points out, “When the restaurants and stores where we sell our products are successful, it makes us more successful, too.”

Routt notes that for the continued growth of the Farmer’s Market, partner-ships with the City, Col-lege, and local businesses are a real key. In the mini mall/antique store model, each vendor depends on the success of the other vendors in the store to help attract customers.

Both Hackbert and El-

liott agree that businesses in Berea have to reach a market beyond just Berea, whether that is visitors to town or to neighboring communities. While Cle-mentine’s sells locally at Happy Meadow and the Farmer’s Market, their largest outlet is Market on Main in Somerset.

Also, those creating their own employment need to do their homework. Hack-bert has his students do research by talking with potential customers and other businesses in the field. The City offers an en-trepreneur class that helps local freelancers make the step to open a business. El-liott and Windland admit a little sheepishly that they have never taken an entre-preneur class or done any market research because they are too busy baking. But they have a mentor at a wholesale bakery in Wash-ington that has generously

shared his successful busi-ness model and informa-tion.

One of the largest barri-ers to people taking on the freelance model, Hackbert notes, is health insurance. Elliott & Windland have found the Kynect system helpful in finding an af-fordable insurance plan as they grow their business.

Hackbert has the idea that Berea could become known as a town of experi-mentation and innovation. Assets like the solar farm, the local food movement, the working artist studios, and workshops offered throughout the year are a solid foundation. But the potential of adding numerous freelancers in creative clusters around Berea could create a more hip and edgy college town where people want to live and visit.

BUSINESSCONTINUED FROM PAGE A1

Charles said, who grew up next to White Station in Madison County.

Charles, who will turn 90 on March 10, has lived in Madison County his entire life, except for a few years where he lived in Ohio and worked in construction. He attended Slick Rock Elementary, a one-room schoolhouse, before at-tending Madison High in Richmond.

When comparing his years growing up in the early 1930s to the present, he said with a grin, “we sure didn’t have all these blacktop roads!” He grew up on a farm that his step-father rented, since his fa-ther passed away before he turned one year old. His two older siblings have al-ready passed away, but he still has a half brother and a few half sisters still liv-ing.

Charles, whose mother’s name was Mary Ballenger, dropped out of school af-ter eighth grade to help out on his stepdad’s farm, where they raised tobacco and corn. He also took odd jobs, and eventually worked as a carpenter’s assistant. That became his trade, and he made furni-ture and cabinets out of a little shop in his garage as a side business.

In 1957, Charles was hired by Berea College as a supervisor in facilities management. He worked there for 38 years, and re-members making $1.25 an hour when he was first hired. He and his wife, Edna McHone, already had one child, Carolyn, who was nine when Charles took the job at Berea Col-lege. A year later their son, Kenny, was born.

Along with work and family, Charles’ life has re-volved around the church. Early in his 20s, he received a call to ministry from God. He assisted Elmer Barrett at Bearwallow Ho-liness Church, and eventu-ally took over as pastor; he continues to preach to this day.

Church, he said, has been his favorite thing along with spending time

with his family. He leads a church service at The Ter-race on Tuesday nights, preaches at Bearwallow a few nights a week, and will visit neighboring churches on the other nights. A very sprightly nonagenarian, Charles expresses grati-tude to God for his con-tinuing good health and energy.

He has lived with his son, Kenny and their fam-ily for 20 years off of High-way 1016, near the Bob-town area. Though it isn’t always easy having three generations in the same household, it has been a positive experience for all of them, and Charles en-joys spending time with his grandchildren. Kenny said his dad has always been careful about in-terfering with their par-enting, and will “leave the room,” when they’re about to issue a punish-ment.

Growing up, Kenny said their family didn’t take a vacation because the church kept them so busy, but once he got a driver’s license he took his mother to Florida. Fortunately, Kenny said, he was able to do this before she died. Years later, he was finally able to pull his dad away from the church so he could take a vacation as well.

Kenny remembers at-tending one of the reviv-als with his father when he was very young. They didn’t have a lot of mon-ey, so when Kenny saw the collection plate get-ting passed around, he thought that looked like a good way to make some extra cash.

“I went around and took a collection for myself,” Kenny said, “and when we got home Dad had a discussion with me.”

Kenny said their father wouldn’t spank them, but would sit down and have long discussions about their actions, and the con-sequences.

“By the time he was done, I wished he would have just given me a whooping,” Kenny said smiling.

But a “whopping” wasn’t quite the discipline style of his gentle father, Kenny said.

The next day, Kenny went back to the revival, and on the instruction of his father, tried to return the money. The church attenders, however, wouldn’t take the money back.

Charles regrets not being able to work the way he used to, but is grateful that he can continue with his ministry at Bearwallow.

“I really enjoy meeting people,” Charles said, as he thinks about his work at the college, and at the church. “I never meet a stranger.”


CHARLESCONTINUED FROM PAGE A1

Physicist and philoso-pher Dr. Vandana Shiva, who has been called an environmental “hero” by Time Magazine, will be speaking Thursday at a Berea College convocation at 3 p.m. in Phelps Stokes

Chapel. Shiva, the director of the

Navdanya seed-saving network in northern India, will speak on Making Peace with the Earth at the Berea College convo on March 3. Shiva will discuss the role that women play in pre-serving the eco-balance of the world’s food system.

Dr. Shiva’s visit to Berea is co-sponsored by the con-vocations program and by the Berea College Women’s & Gender Studies depart-ment, which is observing its 25th anniversary during 2016.

Shiva is the author of

more than 20 books, and was identified by Forbes magazine as one of the “Seven Most Powerful Women on the Globe” for changing the practice and paradigms of agriculture and food.

In 1991, Shiva found-ed Navdanya, a national movement to protect the diversity and integrity of living resources – especial-ly native seed – and to pro-mote organic farming and fair trade. For the last two decades, Navdanya has worked with local commu-nities and organizations, serving more than 500,000

men and women farmers, resulting in the conserva-tion of more than 3,000 va-rieties of rice from across India. The organization has established 60 seed banks in 16 states across the country.

How much can I expect to receive?

BABY BOOMERS HAVE YOUR QUESTIONs ANSWERED!

SOCIAL SECURITY SEMINARat 145 Plaza Drive, Berea, KY

How can I maximize my benefits?

When should i apply for social security?

Will social security be there for me?

Presented by Craig Loftis, CPCU, CLF

Thursday, March 10th – 5:30 P.M.Thursday, March 24th – 5:30 P.M.

To RSVP, Call (859) 986-2371

Sponsored byRegister today! Space is limited, act fast!

free tax prep

Volunteer income tax assistancePreparation by IRS certified volunteers

For more information or to register please call1.800.378.3778

Join us every Thursday January 28th - April 14th

5:30pm - 8:00pmSaturday

January 30th, February 13th, & march 19th9:00am - 4:00pm

Union Church Community Room200 prospect st.Berea, KY 40403

The chief meteorologist of Channel 18, Bill Meck, made his annual visit to Paint Lick Elementary

School a couple of weeks ago to teach his Weather 101 to fourth graders.

Paint Lick students

learned about the science of weather as Meck in-volved students in vari-ous experiments. Using

student participants, Mr. Meck demonstrated how rain, wind, thunder, light-ning, and tornadoes form.

Weather Guy Visits Paint Lick Elementary

“Environmental Hero” to Speak at Berea College

Come Out & Play Rook

Join us for a fun night of cards, great chili and delicious deserts. If you do not play Rook, you can eat and network with other members of Berea's business community and possibly win a nice door prize.

Friday, April 22, 2016 6:00 - 10:00 p.m.

$13.00 per person

Tickets can be purchased by calling 986-9760.

Chamber fundraiser to be held at: Glades Christian Church Fellowship Hall

530 Glades Road, Berea, KY

A Berea Chamber of Commerce Event

4th Annual Rook Tournament

www.BereaChamber.com

425 Richmond Rd. Berea (859) 986-2688

CongratulationsClass of 2015!

NEW CAR WASH

COMING SOON!

Your Best Source for Tires, Auto

Service & Repair

Try it, You’ll Like It!

Thursday, March 3, 2016 Page B1

King’s Eye Care

(859) 986-7027 • 109 Boone Streetwww.eyedoctorberea.com

Eyes are for life, protect them with an Eye Exam

Dr. Gary E. King & Dr. Sarah KingOPTOMETRISTS

Newest Technology:• Retinal Photos• Measure Eye Pressure without drops or puff of air• Computerized Exam

GLASSES & CONTACT LENSESEVENING APPOINTMENTSMOST MEDICAL & VISION

PLANS ACCEPTED

“What music do you groove to

and why?”

Mary Hayes said, “Stuff from the 70s and 80s. Rock and Roll. You can understand every bit of it. It makes

sense.”

Rachel Caltagerone said, “Folk. I think it has a good vibe and it usually means something. It’s not just words.”

Paul Caltagerone said, “Reggae. It’s just calm and collected and it talks

about good times.”

Tiffany Kelley said, “Country, because I was raised country.”

By Critley King/Berea Citizen

Apartments • Storage Space • Office/Retail Spacewww.redcoltproperties.com

Like Us On

(859) 986-0175208 Pauline Drive, Suite F

HE

ALT

H &

W

EL

LN

ES

S

Photos SubmittedAt the State Swim Meet in Louisville this past week, Flanary Patter-son, above, an eighth grader at Farristown, finished 3rd in diving. She

celebrates her victory with her sister, Lainey Patterson, who competed at state, but didn’t make it to the finals. Brandon Turner, above right, with his coach, John Stratman, is a sophomore at Madison Southern, and finished 15th in the 100 yard breaststroke at the State Swim Meet. Flanary and Brandon are the first swimmers/divers from Berea to score

points at the State Swim Meet Finals.

For the first time ever, swimmers from Berea earned medals at region-al competition, and ad-vanced to the state swim meet to earn points

At Regionals in Barbour-ville on Feb. 12 - 13, Flanary Patterson placed 1st in diving and Brandon Turn-er placed 3rd in the 100 breaststroke, giving them entry to the State Swim Meet this past Thursday through Saturday, Feb. 25-27 in Louisville. There they

both scored points, with Flanary placing third in diving at state, and Bran-don placing 15th in the 100 yard breastroke.

The Madison Southern swim coach is John Strat-man.

Other swimmers from Southern competed well, and even broke school records, at the Region 8 Swim Meet at Stivers Aquatic Center in Barbo-urville. Preliminary com-petition was held on Fri-

day, Feb. 12, and the top 16 swimmers from each event returned on Saturday for the final competition.

Swimmers who returned on Saturday for finals, and set new school records, were Megan Frontz, Ally Bowling, Flanary Patter-son and Lainey Patterson for the girls 200 Medley Relay; Brandon Turner for the 200 Individual Medley, and the 100 Breaststroke; Brandon Turner; Matt De-vere, Carter Smith, Bran-

don Turner and Ben Gil-liam for the Boys 200 Free Relay; and Megan Frontz, Ally Bowling, Flanary Pat-terson and Lainey Patter-son for the girls 200 free relay. Flanary Patterson broke a school record in diving.

Other swimmers return-ing for finals were Lainey Patterson in diving; Carter Smith, Ben Gilliam, Ryan Branstutter and Paul Frantz for boys 400 free re-lay; and Courtney Baktis,

Hannah Robinson, Kyla Lloyd and Brooke Tomp-kins for the girls 400 free relay.

Hannah Robinson broke the school record for the 100 Butterfly.

Competing in the state meet were Lainey Patter-son, ranked 19th in diving, Flanary Patterson, ranked 1st in diving, and Brandon Turner, ranked 15th in 100 Breaststroke. Brandon was also the 1st alternate in the 200 Individual Medley.

Berea Swimmers Score at Regional & State Meets

Homemakers Learn About Early Signs for Heart Attacks

The Silver Creek Homemakers Febuary meeting was a lot of fun with 20 members present along with two visitors, Gayle Pow-ell and Jennifer Gergen, that we welcomed.

Peggy Brookshire brought our awareness to Febuary’s Heart Health Month and spoke about early signs for women of heart attacks. They can be quite differ-ent than those for men. Women should talk to their doctor if they have acid reflux more than once a week; that could be a begin-ning stage of heart trouble.

Our main lesson on “Commu-nicating Essentials” was given

by Marian Abbott. She gave us a few tips on active listening, which is actively trying to un-derstand what the other person is trying to communicate to you. There are four parts of listening: 1. Hearing - the physical pro-cesses of taking in sound; 2. In-terpreting - the process of find-ing meaning in what is being communicated; 3. Evaluating - determining the significance of what’s being said; and 4. Re-sponding - the act of replying or answering back.

Body language is particularly important because of how you are perceived. It is the unspoken

message being expressed. When you are speaking it is important to keep and maintain eye contact with someone. Give a smile, it shows confidence.

We hope you have enjoyed these small tips of life’s lessons. We invite you to be a part of Sil-ver Creek Homemakers. It meets the first Thursday of each month at the UK Extension office on Duncannon Lane in Richmond.

If you have any questions please call 859-623-4072.

Submitted by Leveta McClellan

Berea residents enrolled at Berea College were named to the Fall 2015 Dean’s List.

Shauna Abdulsamea, Ashley Ai-ken, and Huda Al-Sammarraie were named to the Dean’s List. They had to achieve a GPA of 3.4 or higher for a minimum course load equivalent to 16 semester hours.

Patricia Watson of Berea received a bachelor’s degree with a major in child and family studies on Sunday, December 13 from Berea College. Watson plans on spending time with her three children before continuing with her studies at grad school.

Berea Students Honored

B2 The Berea Citizen Thursday, March 3, 2016

BUSINESS DIRECTORYCERTIFIED PUBLIC ACCOUNTANTS

GENERAL & COSMETIC DENTISTRY

NEWSPAPER

INSURANCE & FINANCIAL PLANNING

PHARMACY• Berea Drug - US 25 North. 986-4521.• Knights Pharmacy - 191 Glades Road. 986-0500.

• The Berea Citizen - 711 Chestnut Street. 986-0959.

• Danny Miller, Registered Representative New York Life Insurance Company 208 Pauline Drive, Suite C, Berea. 985-8473.

• Mary Oldfield, DMD, PSC - 126 N. Broadway, Berea. 986-2060.

• Robert Michael McCord CPA - 122 S. Killarney, Richmond. 623-8500. or 400 North Richmond Road, Berea. 986-1919.

BANKS• Community Trust Bank - 525 Walnut Meadow Road, Berea. 985-0561.

Local News

M A R R I A G E S

February 5Anne Loxi King, 43,

Richmond, self-employed, to Joshua Glenn Robbins, 32, Brodhead, executive as-sistant

February 19Jennifer Ann Jelf, 38,

Lexington, assistant man-ager, to Paul David McK-inney, 38, Richmond, self-

employedFebruary 20Leanne Pullins, 55, Rich-

mond, pharmaceutical sales, to Donnie Dell Head, 60, Richmond, retired CSX conductor

Chasity Brooke Kirby, 25, Richmond, factory, to Timothy Charles Austin, 28, Richmond, security

Suzanne Marie Polis, 41, Richmond, Kentucky Riv-er Foothills, to Chad Mi-chael Lee, 42, Richmond, delivery driver

February 24Brenda Marie Pearson,

28, Richmond, home-maker, to Eugene Franklin Dyer, 27, Waco, construc-tion

Two chapters of the Daughters of the American Revolution (DAR) joined together for a food and fund collection for the Berea Food Bank. From left to right are Berea-Laurel Ridges members Joyce Mosher, Wanda Lombardo, Brenda Moss, Nina Locker and Mary Beth Bevins; Jerry Workman, director of the Food Bank; and Linda Jen-nings, chapter regent.

The Search is on…FIND THE CITIZEN!

Did you see him last week? He wasn’t easy to spot but

he was in there!

Join in the hunt!

Every person who correctly identifies his whereabouts each week will be placed in a

monthly drawing to

WIN $25.00!Be sure to call or email us prior to the

publication of the next edition.

This Saturday, the teen group at Berea Friends Meeting (Quaker) are holding a spaghetti and talent show fundraiser.

The dinner will start at 6 p.m., with a silent auc-tion also taking place with items such as art and jew-elry. Following will be the talent show with lots of music, along with a couple

of acts that might be more questionable in terms of “talent.”

Jonathan Schinhofen, one of the teen group lead-ers, said, “The evening should be a lot of fun for people, and it’s also a good chance for the community to see our meetinghouse.”

Tickets are $5. The mon-ey raised will go towards

the retreats the teenager attend several times a year, to other meetings in their region.

The Berea Friends Meet-inghouse is located on Harrison Road, past the Berea Municipal Utilities building. Call 859-248-7307 with questions or for more information.

Quaker Teens Hold Spaghetti Dinner/Talent Show Fundraiser

The Berea-Laurel Ridg-es and the Jemima Boone Chapters of the Daugh-ters of the American Rev-olution joined together for “Hearts for Hunger,” a February food and funds donation to the Berea

Food Bank. Representatives of both

chapters met at the Berea Food Bank on February 29 for an interesting program and to present the dona-tions to Jerry Workman, food bank coordinator.

Members of the Berea-Laurel Ridges Chapter donated funds, and mem-bers of the Jemima Boone Chapter of Richmond do-nated non-perishables.

DAR Donates to Berea Food BankThe Berea Lion’s Club welcomed Thomas Ahrens as its speaker on Feb. 22 at the Smokehouse Grill.

Thomas, a native of Ger-many, spoke of the cus-toms and culinary dishes from his home. One of the

highlights of his talk was his singing of an early Ger-man freedom song, Die Gedanken Sind Frei (The Thoughts Are Free). Ahrens serves as the director of convocations for Berea College.

From left to right are Nina

Locker, club president, Thomas

Ahrens, and James Anderson

Thomas. Thomas was presented

with a Lion’s Appreciation artwork.

Ahrens Addresses Lions Club

F O R E C L O S U R E S

Foreclosures filed in Madison County Circuit Court between February 15, 2016 - February 26, 2016:

February 15Quicken Loans Inc. vs.

Fredonna Ritchie; John CCX - executor of Estate

February 16Wells Fargo Bank vs.

John A. FarmerFebruary 17Blueshine LLC vs. Jo

Ann CremeansFebruary 19JP Morgan Chase Bank

vs. Stephen R. AndersonNationstar Mortgage

LLC vs. Everett R. Dur-ham

February 24Bank of America vs. Su-

san TaylorFebruary 25Pennymac Loan Ser-

vices LLC vs. Jacqueline Williams

February 26Deutsche Bank National

Trust Company vs. Mi-chael K. Frazier

February 19Halaina Abagail Hisle

vs. Billy Ray HisleCabinet for Health and

Family Services Ex Rel Casey N. Mullins vs. Ches-ter D. Mullins

Shonda Anderson vs. Jackie Anderson

Pablo Perdomo Hernan-dez vs. Rhonda Saylor

Jessica Draper vs. Wil-liam Cope

February 22

Kristin Isaacs vs. Jason Lynn Isaacs

Becky Ann Riley vs. Da-vid Everett Riley

Tommy Masters III vs. Amanda Masters

Douglas G. Owen vs. Leonara Rizzati Liska

London Cole vs. Bran-don Cole

February 23Robert Fetter vs. Kay N.

FetterFebruary 24

Linda Newkirk Yar-brough vs. Matthew Bar-brough

February 25Jamie E. Sosby vs. James

B. SlaughterJoe E. Thompson vs. An-

gelia ThompsonFebruary 26Kayla Nicole Murphy vs.

Shaun Christopher Mur-phy

Domestic and Family cases filed in Madison Co. Circuit Court between February 19, 2016 to February. 26, 2016:

Cases may include divorce, child custody or support.

D O M E S T I C F A M I L Y C A S E S

WOR

D S

EARCH

B3 The Berea Citizen Thursday, March 3, 2016 Games

SUDOKU ANSW

ER:CROSSW

ORD ANSWER:

Answer: T.J. Thyne

Answer: Boris Kedjoe

Answer: Melina Perez

Answer: Emeli Sandé

Answer: Didier Drogba

March 6–12

Guesswho’s

turning another yearolder this week!

I was born on March 7, 1975, in Boston, MA. I play Dr. Jack Hodgins on Bones. Who am

I?

I was born on March 8, 1973, in Vienna, Austria. I played Damon Carter on

Soul Food: The Series. Who am I?

I was born on March 9, 1979, in High Desert, CA. I managed the professional wrestling tag team MNM.

Who am I?

I was born on March 10, 1987, in Sunderland, Tyne

and Wear, England. I recorded the hit single, “Next

to Me.” Who am I?

I was born on March 11, 1978, in Abidjan, Ivory

Coast. I was the first African footballer to win the Golden

Foot. Who am I?

ATTICSBASISBATTLEBETTERBILLSBURROWCABINSCHARMCHOIRCORRESPOND-ING

CRIESCYCLEDECIDEDUNESFACTSFISTSFORMSINTERSECTIONJUMPSKISSESLANDS

MOVIEPINCHPOOLSQUEENRATESREFERRINGRURALSALTYSCRAPESEALSSNAPS

STATESTATUESTEMSSTILLSTONESTYLESWEETSTABLETAKESTHERMOM-ETER

TIMERTRUNKTRUSTTWINSUSUALWINDSWRITER

CROSSWORD PUZZLE

ACROSS

1. OFFICE CLAMPER8. POSTULATES15. HALO16. FARM LABORER OF LOW SOCIAL RANK17. BAKED DISH18. ANXIOUSLY19. ABOVE20. DILLY-DALLY22. CHEESECAKE INGRE-DIENT?23. ISLET24. ARID25. “FRASIER” ACTRESS GILPIN26. JAGGED, AS A LEAF’S EDGE28. APPLY GENTLY30. DOMESTIC ANIMAL SKIN DISEASE31. SOME SPEECH SOUNDS33. TOLD OF AN OCCUR-RENCE35. HAPPINESS

37. NEWSPAPER STORIES40. LIKE SOME KNEES44. DESTINED45. “___ ANY DROP TO DRINK”: COLERIDGE47. COMMEMORATIVE MARKER48. CONSTRUCT49. COLD CUTS, E.G.51. CAMBRIDGE SCH.52. BAUXITE, E.G.53. UTTERED AN ATTRAC-TION CALL56. SPOIL, WITH “ON”57. KITTY59. ENTHUSIASTIC SUP-PORTER61. ONE RECITING IN A SINGING TONE62. SUBJECT OF THIS PUZZLE63. ORPHANED CHILD WITH NEW LEGAL FAMILY64. PUTS INTO AP-PROPRIATE FORM FOR PUBLICATION

DOWN

1. A MUSLIM2. NEW ZEALAND LIZARD-LIKE REPTILE3. DRY GULCHES4. CHICK’S SOUND5. COURT PLOY6. SAY “LI’L ABNER,” SAY7. HOLD BACK8. ACTED LIKE9. CLOSE, AS AN ENVE-LOPE10. DRESSING INGREDI-ENT11. “IT’S NO ___!”12. MARGIN13. BLOW UP14. BLOCKED21. CAUSING FATIGUE24. BLUE-RIBBON25. BRING UP27. TEXAS/LOUISIANA BORDER RIVER29. “WANNA ___?”30. FAIR TO MIDDLING32. “DO THE RIGHT

THING” PIZZERIA OWNER34. STOP ON A CRAWL36. BIG ___ CONFER-ENCE37. CLEANING CHEMICAL38. BEHIND39. FINDS AN INTEREST (2 WDS.)41. VERNACULAR42. SNOB43. PICKS UP46. ILLICIT CIGARETTE50. “HASTE MAKES WASTE,” E.G.53. COPPER54. ARCH TYPE55. SHREK, E.G.56. COMPUTER INFO58. BLOUSE, E.G.60. AFFIRMATIVE ACTION

Puzzle 1 (Medium, difficulty rating 0.56)

5 9 8 1 3 6 2 4 72 3 7 8 5 4 1 6 94 6 1 9 7 2 3 8 51 5 6 3 8 7 9 2 43 7 4 2 1 9 6 5 88 2 9 4 6 5 7 3 17 8 3 5 2 1 4 9 69 1 2 6 4 8 5 7 36 4 5 7 9 3 8 1 2

SUDOKU

FOR ADVERTISING RATES

AND INFORMATION

CALL SHEILA JOHNSON

986-0959

CryptoQuiz

She was considered one of the greatest artists of the 20th century:

____________________________________

Answers: 1) Mexico, 2) Polio, 3) Folk Art, 4) Self-Portraits, 5) Mythology, Frida Kahlo

Each of the following cryptograms is a clue to the identity of a woman in history. Using the hints U=O and M=L, decipher the clues to name the woman.

R A V O L U__________

S U M O U_________

W U M Q D Y K______________

N A M W – S U Y K Y D O K N_________________________

R J K G U M U T J________________

3

2

4

5

1

In need of a crown or bridge?You can get crowns and bridges in one visit with Our

Cerec Omnicam-Cad/Cam technologyNO IMPRESSIONS NO TEMPORARIES

SPECIAL!ALL New Patient Exam, Cleaning, and Check Up X-rays

$99 For Adults and Children

OUR GOAL: Compassionate Comprehensive Dentistry for all ages

In need of a crown or bridge?You can get crowns and bridges in one visit with Our

Cerec Omnicam-Cad/Cam technologyNO IMPRESSIONS NO TEMPORARIES

SPECIAL!ALL New Patient Exam, Cleaning, and Check Up X-rays

$99 For Adults and Children

OUR GOAL: Compassionate Comprehensive Dentistry for all ages

Jones Family & Cosmetic DentistryMelissa Jones, DMD

201 Pauline Drive • Berea, KY 40403 • 859-985-0201

Accepting New Patients

Jones Family & Cosmetic DentistryMelissa Jones, DMD


8 1 3

3 8 4 1 6

6 9 8 5

6 4

7 1 5

8 7

7 8 1 9

1 2 6 8 7

9 3 8


Page B4 Thursday, March 3, 2016

The Berea Citizen encourages everyone to attendthe worship service of their choice...

AUTOMOTIVE RECYCLING CENTER(859) 985-1151

TOLL FREE 1-877-500-PART

NEW AND USED PARTS666 Mt. Vernon Road, Berea, Kentucky 40403

NEAR NEW AUTO CENTERUS 25 North, Berea, KY

800-735-1028CERTIFIED DEALER

VIEW OR SPECIALS AT WWW.NEARNEWAUTO.COM

Since 1976SAVE MONEY DRIVE BETTER

®-NO BULL-

“Just Good Deals!”

Come See the

DifferenceDiscount SalePrices

Assemblies of God • New Life Assembly of God, 1002 Paint Lick Rd., Berea, Pastor Ricky Rector, Sunday worship 11 a.m. For

details, call 986-9880.Apostolic

• Potter’s House of Restoration Ap-ostolic Church, 217 N. Estill Ave. in Richmond, Pastor Johnny Brindley. Sunday service 2 p.m., Thursday at 7:30 p.m. Call 606-234-5167

• Calvary Apostolic Church, 1382 Paint Lick Rd., Sunday worship 2 p.m., Pastor Alan Peevler. For details, call 986-7830 www.cacberea.com

Baptist• Berea Baptist Church, 310 Chest-

nut St., Pastor Kevin Slemp, Early service 8:15 a.m., Sunday School 9:30 a.m., Sunday worship 10:45 a.m. For details, call 986-9391

• Bethel Baptist Church, 847 Scaf-fold Cane Road, Pastor Kenny Davis, Sunday worship 11 a.m. 986-7341.

• Bethlehem Baptist Church, Drey-fus Road, Pastor Mark McGuire, Sun-day worship 11 a.m. For details, call 986-1711.

• Blue Lick Missionary Baptist Church, Blue Lick Road, Pastor Jim-my Lakes, Sunday worship 11 a.m.

• Calvary Baptist Church, 614 Rich-mond Road, Pastor Wayne Miller, Sunday worship 11 a.m. For details, call 985-9788.

• Conway Baptist Church, US 25S, Conway, Sunday worship 11 a.m., Bro. Bobby Turner, 606-308-2055. Sun-day evening 6 p.m.

• Church on the Rock, 1049 Rich-mond Road, the Rev. Mark Sarver, Sunday worship 10:45 a.m. For de-tails, call 986-1899.

• Dixie Park Cornerstone Baptist Church, N. Powell Avenue, Bro. Joe VanWinkle, Sunday worship 11 a.m.

• Emmanuel Baptist Church, 1456 Paint Lick Road, Pastor Joey Kays, Sunday worship 11 a.m. For details, call 986-2604.

• Faith Baptist Church, 486 Battle-field Memorial Hwy, Pastor John Doss. Sunday services 11 a.m. & 6:30 p.m. 859-625-8548.

• Faith Decision Baptist Church, 1335 Guynn Road, Paint Lick, Pastor Douglas Wilson. Sunday worship 11 a.m.

• Farristown Baptist Church, Mene-laus Road, Farristown, Interim pastor, Minister Ray Reed, Sunday worship 11 a.m. For details, call 986-2716. Van ministry, 986-3770.

• First Baptist Church of Berea, 459 Walnut Meadow Pike, the Rev. J.K. Cunningham, Sunday worship 11 a.m. For details, call 986-2127.

• Friendship Valley Baptist Church, 740 Red Lick Road, Big Hill, the Rev. Ralph Shepperson, Sunday worship 11 a.m.

• Galilee Baptist Church, Mason Lake Road, Pastor Lee Abney, Sunday worship 11 a.m. For details, call 985-0471.

• Gethesmane Baptist Church, Old U.S. 25, Pastor Ed Cortez, Sunday worship 11 a.m. For details, call 986-0655.

• Gloryland Baptist Church, Rich-mond Road, Pastor Cecil Burns, Sun-day worship 11 a.m. For details, call 624-3023.

• Grace Baptist Church, Activities Room of Oh! Kentucky Campground, KY 21W, Pastor Jim Murriner, Sunday worship 11 a.m. For details, call 986-1129.

• Hays Fork Baptist Church, 4447 Hays Fork Lane, Richmond. Minister Samuel Smith, Sunday worship 11 a.m. and 6:30 p.m. Sunday evening.

• Knob Lick Baptist Church, 225 Knob Lick Road, Irvine. Preacher Fred Livinggood, Sunday worship 11 a.m. 859-353-7215.

• Liberty Avenue Baptist Church, 273 Mt. Vernon Road, Pastor Kenneth Felty, Sunday worship 11 a.m. For de-tails, call 986-9249

• Lighthouse Baptist Church, Gab-bardtown Road, the Rev. Roy Himes, Sunday worship 11 a.m. For details, call 248-2847.

• Macedonia Baptist Church, top of Scaffold Cane Road, Pastor Barry

Hurst, Sunday worship 11a.m.• Middletown Baptist Church, 2253

Menelaus Pike, the Rev. Bill Woods, Sunday worship. For details, call 986-9137.

• New Liberty Baptist Church, Smith Lane, Bobtown, Pastor Alfonso Kenney, Sunday worship 11:15 a.m. For details, call 986-2919.

• New Vision Missionary Baptist Church, 193 Bridge Stone in Berea, Pastor Glen Whittemore. 859-248-5096.

• Owsley Fork Baptist Church, 627 Owsley Fork Road, Big Hill, Bro. Dan-ny Robbins. 986-4481.

• Panola Baptist Church, Panola Road, Waco, Bro. Marvin Neal. Sun-day worship 11 a.m.

• Pilot Knob Missionary Baptist Church, KY 421, Big Hill, the Rev. Greg Lakes, two Sunday worship ser-vices at 8 a.m. and 10:45 a.m. Sunday school - 9:30 a.m. For details, call 985-9342.

• Red House Baptist Church, 2301 Red House Rd., Richmond. Sunday worship 10:45 a.m. For details, call 623-8471.

• Red Lick Baptist Church, 601 Red Lick Road, Big Hill, Pastor Eric An-glin, Sunday worship 11 a.m. For de-tails, call 986-2949.

• Roundstone Missionary Baptist Church, Pastor Jason Brown, US 25 South, Roundstone, Sunday worship 11 a.m. 606-308-1272.

• Silver Creek Baptist Church, 1784 Big Hill Road, Sunday worship 10:45 a.m., Pastor, Dennis Hisle. For details, call 986-LOVE.

• Valley Baptist Church, 4482 Cop-per Creek Road, Pastor Evan Eckler. Sunday worship 11 a.m.; Sunday night 6 p.m. 859-302-3752.

• Wallaceton Baptist Church, 3375 Guynn Road, Paint Lick, Sunday wor-ship 11 a.m. For details, call 986-1671.

• West Side Baptist Church, Prince Royal Drive, Sunday worship 11 a.m., Bro. Allen Livingood. For details, call 986-3444.

• White Lick Baptist Church, Cart-ersville Road, Sunday worship 11:00 a.m. Brother Wayne Dunn. For de-tails, call 925-4641.

Catholic• St. Clare Catholic Church, 622

Chestnut St., Sunday mass 9 a.m., Sat-urday mass 7 p.m. Father Michael D. Flanagan. For details, call 986-4633.

Christian• Glades Christian Church, Glades

Road, Sunday worship 10:30 a.m., Pastor Rick Fulton. For details, call 986-1421.

• Wayside Christian Church, Mene-laus Pike, Sunday worship 11 a.m., Pastor Ron Lutes. For details, call 985-9465.

Church of Christ• Berea Church of Christ, 357 North

Dogwood Drive, Berea. Sunday wor-ship 11 a.m., Bro. Scott Pena. For de-tails, call 986-4438.

•Dreyfus Church of Christ, Sunday worship 11 a.m., Tom Riley. For de-tails, call 893-4022.

Church of God• Berea Church of God, 189 Rash

Road, Berea, the Rev. Steve Hobbs. Sunday worship 11 a.m. For details, call 986-4968.

• Conway Church of God, US 25 South, Conway, Sunday worship 11 a.m., the Rev. C.W. Williams.

• Fountain Park First Church of God, 5000 Secretarian Dr., Richmond. Pastor Ben Jordan, Sunday worship - 11 a.m. 623-3511.

• Paint Lick Church of God, Old RailRoad Bed Road, Paint Lick, Sun-day worship 11 a.m. For details, call 986-3390.

• Harmon’s Lick Church of God, Harmon’s Lick Rd, Sunday service 11 a.m., Bro. Vernon Willard, 792-8639.

Disciples of Christ• First Christian Church (Disciples

of Christ), 206 Chestnut St., Sunday worship 10:40 a.m., Rev. Mark and Rev. Lisa Caldwell-Reiss. For details, call 986-4553.

• Kirksville Christian Church, KY 595 at KY 1295, Kirksville, the Rev. John Poulette, 484-769-9351. Sunday

worship 11 a.m. • Mt. Zion Christian Church, 830

Battlefield Memorial Highway, the Rev. Roger Hurt.

Episcopal• Danforth Chapel, Berea College

Draper Building, evening prayer 6 p.m. on first, third and fifth Thurs-days.

• Episcopal Church of Our Saviour, 2323 Lexington Road, Richmond, the Rev. Marcia Hunter. Sunday Holy Eu-charist and Morning Prayer at 8:30 and 11 a.m. For details, call 623-1226.

Lutheran• St. Thomas Lutheran Church,

1285 Barnes Mill Road, Richmond, Sunday worship 9:30 a.m., the Rev. Barry Neese, pastor. For details, call 623-7254.

Methodist• Berea United Methodist Church,

1-1 Fee St., Sunday worship 8:30 & 11 a.m., the Rev. Phil Bradley. For details, call 986-3485.

• Paint Lick United Methodist Church, 10950 KY 52 West, Paint Lick, Sunday worship 11 a.m. For details, call 925-4441.

Pentecostal• Bearwallow Pentecostal Holiness

Church, Bear Wallow Road, Dreyfus, Pastor Charles Whittamore.

• Berea Evangelistic Center, 180 Plaza Drive, Sunday worship 1 p.m., Pastor Jeff Osborne. For details, call 986-8491. bereaevangelistic.org

• Big Hill Pentecostal Holiness Church, US 421, Big Hill, the Rev. Bill Rose. For details, call 986-4707.

• Holy Pentecostal Sanctuary, Crestview Drive, Bro. Harold Eads.

• Harmons Lick Holiness Church, Harmons Lick Road, Paint Lick, Sun-day worship 11:30 a.m., Pastor Mikie Leger. For details, call 859-893-4367.

• Pony Express Holiness Church, 1711 Big Hill Rd., Worship Mon. - Fri. at 7:30 p.m., Sunday worship 11 a.m., Pastor Artie Jacob Alexander. For de-tails, call 859-893-3654.

Presbyterian• Whites Memorial Presbyterian

Church, 401 White Station Rd., Sun. worship 11 a.m., Rev. Wanda Olive. . Call 986-7734 or go to whitesmemo-rial.weebly.com/.

Religious Society of Friends (Quakers)

• Berea Friends Meeting, 300 Har-rison Road, Sunday worship 10 a.m. For details, call 334-0406.

Other• Church of Jesus Christ of Lat-

ter Day Saints, 156 S. Keeneland Dr., Richmond. Sunday sacrament 10:50 a.m., Bishop Emery Martin. For de-tails, call 624-2067.

• Crossroads Fellowship Church, 60 Old Wallaceton Road, Sunday worship 10:45 a.m., Pastor Jonas Hill. For details, call 859-986-LIFE.

• First Faith Independent Church, Menelaus Pike, Sunday worship 11 a.m., Pastor Gordon Robinson. For details, call 986-3272.

• Liberty Avenue Full Gospel Out-reach, 113 Liberty Ave., Sunday wor-ship 11 a.m., Pastor Donald R. Wilson.

• Liberty Chapel Church, 464 Three Forks Rd., Richmond. Sunday wor-ship - 11 a.m. 859-369-7473.

• Living Waters Sanctuary, Liberty Avenue, Sunday worship 11 a.m., Rev. Dale Holman. For details, call 859-353-2755 or 859-893-1035.

•New Hope Reformed Church, 704 Mayde Road, Sunday worship 10:30 a.m. Pastor Russ Westbrook 606-975-3415. newhopereformed.net.

• River of Life Foursquare Church, 104 John St., Sunday worship 9 & 11 a.m., Pastor Tim Lawson. For details, call 985-7809.

• Rugged Cross Cowboy Church, Mad. Co. Fairgrounds. Thursday at 7 p.m. Pastor Jeff Duncan, contact at 859-608-5322.

• Union Church, 200 Prospect St., Sunday worship, 10:30 a.m. Rev. Kent Gilbert and Rev. Rachel Stokes. For details, call 986-3725.

• Unitarian Universalist Fellow-ship, 1081 Willis Branch Road, Rich-mond, Sunday service 10:45 a.m. For details, call Karen Janssen at 623-1584.

• BEREA’S ONLY CAR RENTAL SERVICE

• DAILY & WEEKLY RENTALS• LOW RATES• INSURANCE

REPLACEMENT RENTALS

BOX VANNOW AVAILABLEFOR MOVING,TRANSPORT, ETC. 200 Richmond Rd North, Berea

(859) 986-7712

202 Richmond Rd N, Berea

(859) 986-7595

240 Brenwood St., Berea

(859) 985-2596

101 Peggy Flat Spur, Berea

(859) 985-7371

3 B E R E A L O C A T I O N S

Barnett’sHeating & Cooling, Inc.

We service all brands30 YEARS IN BUSINESS IN BEREA

Master License #MO2416 • Mike Barnett, [email protected]

office (859) 986-1802

Sammy K. Lee, P.S.C.

208 Pauline Drive Suite DBerea, KY 40403

Phone: (859) 986-3756Fax: (859) 986-0103E-Mail: [email protected]: skleepa.com

Sammy K. LeeCertified Public Accountant

Mom & G’sAutomatic Car Wash

The Best Car Wash in BereaPrince Royal Drive, Berea

Winter Eats CarsWash all that salt off at

“He has made everything beautiful in its time. He has also set eternity in the hearts of men; yet they cannot fathom what God has done from beginning to end.”

-- Ecclesiastes 3:11

P-CAB

986-1111


Calendar announcements should include the name of the event, time, date, location, a brief description and contact telephone number or e-mail address. Announcements promoting sales for profit (unless from a nonprofit organization)

are available through the advertising department. Announcements should be in by noon Monday each week.

“The responsibility of tolerance lies with those who have the wider vision.”

-- George Eliot

SHORT REAL ESTATE GROUP

(859) 985-5577

Call us for all your Real Estate needs.

301 Richmond Road N. • Berea, KY 40403Phone 859-986-8611 • Fax 859-986-8351

[email protected]

Every Thursday• Jammin’ on the Porch, 7 p.m., Rus-

sel Acton Folk Center. Bring instru-ment, join in. Call 986-2540.

• Al-Anon, 8 p.m., Berea Baptist Church, 310 Chestnut St. Enter in back at the Sunday School entrance.

• AA discussion meeting, 8 p.m., Berea Baptist Church, second floor. For details, call 582-6033.

• Celebrate Recovery - Life’s Hurts, Habitats and Hangups, 6 p.m., Liberty Avenue Baptist Church. 986-9249.First Thursday• Berea Community Middle/High School Council Meeting, 5:30 p.m., school conference room. 986-8446. Second Thursday

• Berea-Laurel Ridges DAR Chapter, 10 a.m. For details [email protected].

Fourth Thursday• Marine Corps League, 7 p.m., 314

W. Irvine Street, Richmond. For details, call 623-0122.Last Thursday

• Marine Corps League, Vet Center, Irvine Street in Richmond. For details, call Craig Pyles, 986-1551.Third Friday

• Berea Lodge #617 F&AM, 7 p.m., lodge hall on Chestnut Street

• Bluegrass Commission on Elder Abuse, 2 p.m., EKU Stratton Building, 623-1204.Fourth Friday • Madison County Health and Well-ness Network (MCHWN), 10 a.m., St. Joseph Berea Hospital. 623-3237.Every Saturday • Support group for people with de-pression and bipolar disorders, 10 a.m., Union Church. Call 353-7047.

• AA, 8 a.m., House behind Method-ist Church facing Fee St. Call 582-6033 or 893-4590.

• Adult Children of Alcoholics, 11 a.m., Union Church. Call Joan S. at 859-421-1291.First Saturday • Families Advocating for the Blind, 10 a.m., Madison County Public Library in Berea.Third Saturday • Berea Writers Circle, 1:30 - 3 p.m., Madison County Public Library in Berea. Fourth Saturday

• Contra Dance, 7:30-11 p.m., Rus-sel Acton Folk Center, cost is $8, $5 for students/seniors. For details, call 985-5501.Last Sunday

• Experimental Aircraft Association, Chapter 892, 1 p.m., Madison Airport.Every Monday

• Walking the 12 steps with Jesus Christ, 6 p.m., Great Commission Out-reach Church. For ride or information, call Kim at 859-353-7772.

• Al-Anon, 6 p.m., Union Church, Wayside Room on Prospect St. For de-tails, call 606-256-4891.

• AA, 7 p.m., Union Church-Rm 104.First Monday

• PFLAG (Parents and Friends of Les-bians and Gays), 7 p.m. For meeting location, call 200-9512.

• Berea Lodge #617 F&AM, 7 p.m., Lodge Hall on Chestnut Street.

• Madison Southern Football Boost-ers, 6:30 p.m., school library.

• Berea Kiwanis Club, 6 p.m., Dinner Bell Restaurant.

• Berea Human Rights Commission, 6:30 p.m., community room at Berea City Hall.

• Friends of NRA, 6:30 p.m., First Christian Church on Chestnut St. Con-tact Jim Lucas at 985-8906.Second Monday

• Berea Lions Club, 6:30 p.m.,

Smokehouse Grill.• Madison Southern Core Curriculum

Committee, 3:00 p.m., school library. For details, call 986-8424.

• Younger Woman’s Club of Berea, 6 p.m., Dinner Bell. For details, [email protected] Monday


• Berea Community School Board meeting, 7 p.m., Kennedy Theater.First & Third Mondays

• MadCo Toastmasters Club, 7 - 8 p.m., Central Bank in Richmond. Con-tact 859-582-9543.Fourth Monday

• Madison County Chapter of Ken-tuckians for the Commonwealth, 7 p.m., Berea College Appalachian Center on Main St. For details, call 985-7480.

• Berea Lions Club, 6:30 p.m., Smokehouse Grill.Every Tuesday

• Berea Rotary Club, noon, Kentucky Artisan Center.

• TOPS (Take Off Pounds Sensibly), 6:15 p.m., Berea Baptist Church. For details, call Carol at 859-575-0173.

• Berea Chess Club, 6 p.m., Inter-generational Center. For details, call 986-9866.

• Boy Scouts Troop 51, 7 - 8:30 p.m., basement of First Christian Church.First Tuesday

• Berea City Council, 6:30 p.m., Berea Police and Municipal Center. For details, call 986-8528.

• Madison Airport Board, 3 p.m., terminal building. Public invited. For details, call George Wyatt, 661-1338.

• Berea Business and Professional Women’s Organization, 6 p.m. For meeting details, call 986-7420.Second Tuesday

• Fiscal Court, 9:30 a.m.

• Berea Elementary School SBDM Council, 3:30 p.m., elementary confer-ence room.

• DAV Chapter 160, 6:30 p.m., Berea Senior Citizens Center.

• NAMI Madison County, 5 p.m., Board room of St. Joseph Berea.

• Berea Planning and Zoning Com-mission work session, City Hall. For details, call 986-8528.

• American Legion Post 50, 6:30 p.m., headquarters on Holly Street. Meal provided.Third Tuesday


• Kingston Lodge 315 F&AM, 7:30 p.m., Lodge Hall on U.S. 421.

• Madison Southern High School SBDM Council, 4 p.m., school library. For details, call 986-8424.Fourth Tuesday

• Fiscal Court, 9:30 a.m.• ABLE--support group for different-

ly-abled, 5:30 p.m., Room 101 Union Church. [email protected]

• Berea Planning and Zoning Com-mission regular meeting, Berea Police & Municipal Center. For details, call 986-8528.First Wednesday

• Berea Women’s Club. For details, call 985-1144.

• Berea Ministerial Association, 11:30 a.m.-1 p.m., with a brown bag lunch. For details, call 986-4553 or 986-3725.Second Wednesday

• Berea Tourism Commission, 5 p.m., City Hall. For details, call 986-2540.Third Wednesday


Regular meetings

Calendar of eventsMarch 3• Berea College convo -- Dr. Vandana Shiva on

Making Peace with the Earth, 3 p.m., Phelps-Stokes Auditorium. Shiva discusses moving from econom-ic and ecological debt models to earth-centered politics and economics.

• Story Time, 10:30 a.m., Madison County Public Library in Berea. Fingerplays, songs and stories for ages 2 - 4.

• Free afternoon movie, 3:30 p.m., Madison County Public Library in Berea. Showing The Good Dinosaur. Rated G.

• Jammin’ on the Porch, 7 - 9 p.m., Russel Acton Folk Center. Bring instrument and join in the jam.

• Intermediate cardio tone classes, 5:35 p.m., Russel Acton Folk Center. $3 per class. Sponsored by Berea Parks and Rec.

• Fit Club, 4 p.m., Berea Community School. Free elementary age activities.

March 5• Demonstration of cornshuck dolls, 10:30 a.m.

- 3:30 p.m., Kentucky Artisan Center. Demonstrat-ed by Donna Smith at Waco.

• Berea Farmers Market, 10 a.m., old Churchill Weavers building.

March 6• Chess Club, 1 p.m., Madison County Public Li-

brary in Berea.

March 7• Lego Club, 3:30 p.m., Madison County Public

Library in Berea. For ages 6 through 14.• Intermediate cardio tone classes, 5:35 p.m.,

Russel Acton Folk Center. $3 per class. Sponsored by Berea Parks and Rec.

March 8• Baby and Toddler Time, 10:30 a.m., Madison

County Public Library in Berea. For ages 0 - 2 1/2.• One-on-One Computer Help, 12 p.m., Madi-

son County Public Library in Berea. Assistance with computers, classes designed to answer questions.

• Toddler Tuesday, 10 a.m. - 12 p.m., Russel Ac-ton Folk Center. Free for 0 - 4 years old, adult must accompany child.

March 9• Lenten Lunch, 12 p.m., Parish House at Berea

United Methodist Church. Will begin with special music, followed by the speaker, Pastor Jill Ruhl from Southern Hills United Methodist Church. Lunch to then be served.

• Crafternoon: Yarn Butterflies, 3:30 p.m., Madi-son County Public Library in Berea.

• One-on-One Computer Help, 12 p.m., Madi-son County Public Library in Berea. Assistance with computers, classes designed to answer questions.

• Introduction to Computers -- Microsoft Office overview, 4 p.m., Madison County Public Library in Berea. Must register -- 986-7112.

• Basic Spanish for Adults, 6 p.m., Madison County Public Library in Berea. Hispanic Outreach Project (HOP) at Berea College is teaching a ten-week Spanish course at the library.

March 10• Story Time, 10:30 a.m., Madison County Public

Library in Berea. Fingerplays, songs and stories for ages 2 - 4.

• Free afternoon movie, 3:30 p.m., Madison County Library in Berea. Showing Peanuts.




March 12• Public reception for the Community Art Show

and Young at Art Exhibit, 2 - 4 p.m., Berea Arts Council. Exhibit by local artists will be displayed from March 11 to April 16.

• Honey Hill Farm Indoor Petting Zoo, 1 p.m., Madison County Public Library in Berea. Will in-clude exotic chickens, guinea pigs, ducks, chinchil-las, and more.


• Felted Easter egg ornaments demonstration, 10:30 a.m. - 3:30 p.m., Kentucky Artisan Center. Tonya Vance to demonstrate.

• Author Jim Shields of Lexington to sign new children’s book, Welcome Baby Bunnies!, 11 a.m. - 2 p.m., Kentucky Artisan Center.

March 12

• Lenten Lunch, 12 p.m., Parish House at Berea United Methodist Church. Will begin with special music, followed by the speaker, Pastor Mike Pow-ers, from Lexington First United Methodist Church. Lunch will then be served.

• Gospel Singing, 6 p.m., Lighthouse Baptist Church on Gabbardtown Road. Featuring New Har-vest from Tenn.

March 13• Meet-the-Artists Reception, 1:30 - 3 p.m.,

Kentucky Artisan Center. Artists from the center’s exhibit, Great Impressions: Prints by Kentucky Arti-sans to be present.

March 14• Annual Meeting for Sustainable Berea at First

Christian Church. Dessert at 6:30 p.m., and meet-ing at 7 p.m. Speaker from Chicago Botanic Garden will speak on “Edible Landscaping: Beauty and Bounty in Your Yard.” Baked goods auction at 8 p.m.

• Yoga for Every Body -- Free Yoga Classes, 9:30 a.m., Madison County Public Library in Berea. Free, beginner-level class, taught by certified instructor Carrie Mahoney. Must register -- 986-7112.

• Lego Club, 3:30 p.m., Madison County Public Library in Berea. For ages 6 through 14.


March 15• Baby and Toddler Time, 10:30 a.m., Madison

County Public Library in Berea. For ages 0 - 2 1/2.• Toddler Tuesday, 10 a.m. - 12 p.m., Russel Ac-

ton Folk Center. Free for 0 - 4 years old, adult must accompany child.


• AppalSeeds Heirloom Seed Starting Work-shop, 6 p.m., Madison County Library in Berea. Learn how to plant from seed, save seeds, and transplant seedlings. Participants will also receive heirloom seeds. Must register -- 986-7112.

• Workshop on Urban Gardening: Make the Most of the Space You Have, 7 p.m., Madison Coun-ty Public Library in Berea. Horticulturist Lisa Hil-genberg from Chicago Botanical Garden discusses gardening in limited space.

For all your heating and cooling needs,

call Steve King at Modern Air Inc.

859-985-5352www.modernairky.com

It’s all about indoor comfort.

DAVID MAYOAgency Manager

216 Pauline Drive,Berea, Kentucky 40403

(859) 986-2318Hours: Monday-Friday

8:00 a.m.- 4:30 p.m.

BIG ONCOMMITMENT

AutoFarmHome

RentersHealthMobileHomeBoatLife

Business

DANNY MILLERINSURANCE & FINANCIAL SERVICES. INC.M

Life Insurance • Long-Term Care Insurance • Health Insurance Retirement Planning • Estate Conservation • Traditional / ROTH IRAs

Simple IRAs • Disability Insurance • 401ks / Rollovers Medicare Supplements • College Funding Strategies

208 Pauline Drive, Suite C • Berea, KY 40403Phone: 859.985.8473 • [email protected]

Danny MIller is a Registered Representative offering securities through NYLIFE Securities LLC, Member FINRA/SIPC, A Licensed Insurance Agency, 9300 Shelbyville Rd., Ste 1250, Louisville KY 40222 502.327.8589. Danny Miller Insurance & Financial Services Inc. is not owned or operated by NYLIFE Securities LLC or its affiliates.

Perhaps I can help.

KY GUILD VISUAL ARTS ACADEMY 116 North Broadway Street

Register for Classes March through November Visit Our Gift Gallery

www.kyguildacademy.com/859-986-3192

BURRIS

PLUMBINGI N S T A L L A T I O N & R E P A I R S

Water heaters, faucets, outside spigots. Experienced, Licensed, Dependable.

Call (859) 986-3928, 302-2030 (cell)127 Plaza Drive, Berea

986-2777

711 Chestnut Street, Suite 4, Berea985-LOAN (5626)

Mon-Fri 9 am to 6 pm

Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



Branch ID#1027421

B.J.Chambers985-5626Mortgage SuppliersNMLS165482

Shauna K Smith859-358-7112

The Smith Group

Call Us Today We can help with all your mortgage and real estate needs!

LAST ACADEMY CLASSES OF THE YEARwww.kyguildacademy.com

New ExhibitAbandonedby Carole Shutt & Linda Blumer

Meet the Artists ReceptionFriday, October 23rd | 5 to 7 pm

Oct. 31 – Nov.1 Cabochons, $200 Chuck Bruce, Instructor

Nov. 7 Intro to Lampworking Beads, $150 Toni Menk, Instructor

Nov. 13 –15 Loop ‘n Loop Chain, $250 Chuck Bruce, Instructor

December 5 Watercolors, $80 Pat Banks, Instructor

Dec. 5 Intro to Lampworking Beads, $150 Toni Menk, Instructor

save the dates

2015Fall FairOctober10 & 11

KGAC is located at 210 N Broadway, Berea • (859) 986-3192 • www.kyguild.org [email protected]

BUY THE BEST!Kentucky Guild Gift GalleryFor that special gift Handmade by KY Guild artists

2016

8 & 9

From February 19 to February 25, 2016

Valerie J. Himes, execu-trix, Harley Lee Richards, Jr. Estate to Boonesboro Post No 7098 Veterans of Foreign Wars, Richmond, KY, 211 Brown Street in Berea, distribution to the named beneficiary un-der the will of Harley Lee Richards, Jr.

Morgan Kirby, Morgan Wilson, San Kirby to Shan-non M. Russell, Miranda J. Russell, 2229 Brass-field Road in Richmond, $130,500

Keith E. Greff, Linda M. Greff to Bill Brab, Alicia Brab, Lot 14, Deer Creek Estates, $220,000

Sycamore Park at Gold-en Leaf LLC to Heather M. Brockman, Lots 43, 48, and 55 Sycamore Park at Golden Leaf in Richmond, $63,000

David Lawson Builders LLC to Helen S. Phillips, Lot 22, Laneybrooke Es-tates, $188,000

CR Properties 2015 LLC to Charles R. Barnes, Mar-garet L. Barnes, 625 Waco Loop in Waco, $26,000

Deutsche Bank National Trust Company, as Inden-ture Trustee, on behalf of the Holders of the Accred-ited Mortgage Loan Trust 2006-2 Asset Backed Notes to Aaron Webb, 240 Red Lick Road in Berea

WM Development LLC to Combs Colt LLC, Lot

13, Black 1 Stoney Creek, agreement between parties

WM Development LLC to Combs Colt LLC, Lot 11, Black 1 Stoney Creek, agreement between parties



Edna J. Noe to Mircea Enciu, Billie Joe Enciu, Lot 1A, Burhart Subdivision near Richmond, $152,700

Ross Reynolds, Michelle Reynolds to RJC Holdings LLC, properties on north side of Oak Street in Rich-mond, $121,000

Secretary of Housing and Urban Development, Washington D.C. to James Frank McClure, Jr., Pamela Gail McClure, 120 E. Lo-

cust Street in Richmond, $28,100

Morgan Ross Properties LLC to Keith Hellyer, Ellen Harshman, Lot 6, Boones Trace Subdivision, $43,900

Charlene Graham to Da-vid Allen, Peggy Allen, property on Sand Ridge Road, $100,000

Champ Properties LLC to Christopher Menser, Dustin Menser, 5083 Stal-lion Drive in Richmond,

$58,000J P M Management Co

LLC to Reeves Property Group LLC, Lot 31, Per-simmon Trace at Golden-leaf, $195,000

J P M Management Co LLC to Reeves Property Group LLC, Lot 32, Per-simmon Trace at Golden-leaf, $195,000

Donald P. Haney, Theda

B6 The Berea Citizen Thursday, March 3, 2016Local News

SEE PROP, PAGE B8

Madison County Detention CenterFrom February 20, 2016

to February 26, 2016

February 20 Glenda Barrett, 46, Rich-

mond, public alcohol in-toxication, second degree disorderly conduct

Melinda Marcum, 44, Richmond, failure to ap-pear

Ronnie Barrett, 50, Rich-mond, public alcohol in-toxication, second degree disorderly conduct, men-acing

Jenny Rogg, 28, Rich-mond, first degree pos-session of controlled substance, first degree pro-moting contraband, first degree possession of con-trolled substance – meth-amphetamine

Cassandra Mansfield, 33, Richmond, first degree possession of controlled substance – methamphet-amine

Joshua Scott, 34, Lexing-ton, failure to appear

Erika Berardi, 25, Rich-mond, serving parole vio-lation warrant, first degree possession of controlled substance – methamphet-amine, buy/possess drug paraphernalia

Donald Hurley, 24, Phelps, serving bench war-rant for court

William Combs, 27, Richmond, first degree possession of controlled substance – methamphet-amine, buy/possess drug paraphernalia

Phillip Surrett, 45, Rich-mond, operating motor ve-hicle under the influence of alcohol or drugs

Gary Rice, 59, Richmond, operating motor vehicle under the influence of al-cohol or drugs

Candi Wright, 31, Berea, first degree possession of controlled substance – heroin, buy/possess drug paraphernalia

David Kilgore, 42, Rich-mond, first degree pos-session of controlled sub-stance, buy/possess drug paraphernalia

Heather Waters, 28, Rich-mond, contempt of court

Michael Richmond, 35, Mt. Vernon, failure to wear seat belts, no rear view mirror, driving on DUI suspended license, operat-ing motor vehicle under the influence of alcohol or drugs, failure of non-own-er operator to maintain re-quired insurance

Michael Couch, 40, Man-chester, speeding 20 mph over limit, failure to wear seat belts, failure to pro-duce insurance card, no registration receipt, oper-ating motor vehicle under the influence of alcohol or drugs, first degree traffick-ing in controlled substance, first degree possession of

controlled substance, buy/possess drug parapherna-lia

Michael Wright, 46, Junc-tion City, failure to appear

Ricky Smith, 36, Man-chester, public intoxication of controlled substance, first degree trafficking in controlled substance, first degree possession of con-trolled substance, buy/possess drug parapherna-lia

Samuel Abner, 39, Man-chester, public intoxication of controlled substance, buy/possess drug para-phernalia, two counts of first degree possession of controlled substance – methamphetamine, non payment of fines, first degree trafficking in con-trolled substance

George Walling, 44, Ir-vine, failure to appear

Teresa Poynter, 26, Rich-mond, public alcohol in-toxication

Steven Nicley, 47, Mt. Vernon, failure to appear

Wendell Parrett, 47, Berea, non payment of fines, failure to appear

Timothy Riddle, 31, Ir-vine, violation of condi-tions of release

Jeffery White, 33, Rich-mond, non payment of fines

Kyle Collins, 20, Rich-mond, failure to appear

February 21Jeremy Gagnon, 29,

Cincinnati, Ohio, careless driving, rear license not il-luminated, failure to wear seat belts, no registration receipt, failure to produce insurance card, operating motor vehicle under the in-fluence of alcohol or drugs

Mark Caudill, 50, Lean-der, non payment of fines, failure to appear

Benjamin Dantic, 19, Richmond, public alcohol intoxication, second de-gree disorderly conduct

Larry Rudd, 60, Stanton, careless driving, operating motor vehicle under the in-fluence of alcohol or drugs

Tyler Webb, 20, George-town, public alcohol in-toxication, third degree criminal mischief, theft by unlawful taking, display or possess cancelled of fic-titious operator license

Kristi Hull, 19, Irvine, two counts of contempt of court, failure to appear

Ryan Weddle, 21, Somer-set, public alcohol intoxica-tion, third degree criminal mischief, theft by unlawful taking

Austin Litteral, 20, Georgetown, public al-cohol intoxication, third degree criminal mischief, theft by unlawful taking

Megan Sanders, 20, Rich-mond, two counts of fail-ure to appear

David Sawders, 33, Rich-

mond, public alcohol in-toxication, carrying a con-cealed weapon

Geneva Morton, 24, Richmond, three counts of failure to appear

Mark Kelley, 48, Rich-mond, theft by unlawful taking – shoplifting under $500

Nathaneil Taylor, 21, Richmond, first degree robbery, first degree pos-session of controlled sub-stance – cocaine, first degree promoting contra-band

Amanda Burns, 32, Waco, third degree bur-glary, second degree rob-bery, two counts of non payment of fines

Lesell Mitchell, 29, Rich-mond, first degree assault – domestic violence

Daniel Baker, 49, Rich-mond, fourth degree as-sault – domestic violence

Melissa Cartee, 28, Rich-mond, theft by unlawful taking – shoplifting under $500

William Wood, 33, Rich-mond, theft by unlawful taking – shoplifting under $500

Luke Marshall, 45, Rich-mond, second degree criminal mischief, second degree wanton endanger-ment, operating motor ve-hicle under the influence of alcohol or drugs

February 22David McIntosh, 53,

Berea, serving bench war-rant for court, third degree burglary, theft by unlaw-ful taking – shoplifting be-tween $500 and $10,000

Ryan Saylor, 21, Cold-iron, failure to appear

Justin Lowery, 29, Rich-mond, two counts of fail-ure to appear

Gary Rogers, 48, Rich-mond, violation of condi-tions of release

James Hurd, 43, Somer-set, receiving stolen prop-erty under $10,000, theft by deception – include cold checks under $500

Abdulham Alrashdan, 29, Louisville, first degree bail jumping

Samuel Vanmeter, 56, Winchester, two counts of reckless driving, first degree fleeing or evading police, first degree wan-ton endangerment, speed-ing 26 mph or more over speed limit, disregarding stop sign

Farris Callahan, 41, Rich-mond, theft by unlawful taking – shoplifting under $500

Joshua Sparks, 31, Rich-mond, theft by unlawful taking – shoplifting under $500

Troy Fitzpatrick, 40, Somerset, theft by unlaw-ful taking – shoplifting un-der $500

Derek Jackson, 21, Lon-

don, failure to appear, theft by unlawful taking be-tween $500 and $10,000

Sarah Riddell, 31, Irvine, non payment of fines

Landis Hester, 35, Berea, fourth degree assault – do-mestic violence

Jessica Saylor, 34, Rich-mond, third degree bur-glary

February 23 Johnathan Kelley, 27,

San Diego, Ca., public al-cohol intoxication, carry-ing a concealed weapon, buy/possess drug para-phernalia, second degree disorderly conduct

David Short, 36, Rich-mond, fourth degree as-sault – domestic violence

Alstin Kemp, 22, Rich-mond, public alcohol in-toxication

Kerry Thacker, 28, Rich-mond, public alcohol in-toxication

John Hughes, 18, Berea, truancy – student 18 but not yet 21, contempt of court

Randall Walter, 57, Al-toona, Pa., failure to ap-pear

Roger Henry, 41, Waco, first degree promoting contraband, operating on suspended or revoked op-erator license, failure to wear seat belts, failure to produce insurance card, non payment of fines, fail-ure to appear

Caitlin Powell, 23, Rich-mond, violation of condi-tions of release

Crystal Gardner, 40, Richmond, violation of a Kentucky EPO/DVO

Ronald Green, 22, McK-ee, public intoxication of controlled substance, con-tempt of court

John Lowery, 38, Rich-mond, fourth degree as-sault – domestic violence

Jared Wehrle, 28, Berea, three counts of violation of Kentucky EPO/DVO, car-rying a concealed weapon, third degree possession of controlled substance, pos-session of marijuana, first degree fleeing or evading police, first degree wan-ton endangerment, third degree criminal mischief, reckless driving, failure to report traffic accident, first degree stalking, first degree burglary, fourth degree assault – domestic violence

Paul Roden, 21, Rich-mond, reckless driving, improper equipment, op-erating motor vehicle un-der the influence of alcohol or drugs, first degree traf-ficking in controlled sub-stance, buy/possess drug paraphernalia, false state-ment/misrepresent to re-ceive benefits

Aaron McGuire, 23, Law-renceburg, leaving scene of accident – failure to render

aid, operating motor ve-hicle under the influence of alcohol or drugs, failure to produce insurance card, failure of owner to main-tain required insurance, first degree criminal mis-chief, buy/possess drug paraphernalia

February 24Stephen Dean, 26, Irvine,

failure to appearMatthew Carmen, 21,

Richmond, second degree escape, tampering with prisoner monitoring de-vice, failure to appear, fu-gitive from another state

Dustin Reynolds, 22, Ir-vine, contempt of court

Nina Johnson, 36, Irvine, theft by unlawful taking – shoplifting under $500, failure to appear

Michael Marlow, 39, Mt. Vernon, theft of mail mat-ter, tampering with physi-cal evidence, persistent felony offender, contempt of court

Mark Wick, 49, Berea, first degree possession of controlled substance – methamphetamine, buy/possess drug parapherna-lia

Scottie Brady, 47, Rich-mond, failure to appear

Kenneth Stepp, 37, Rich-mond, contempt of court

Timothy Rogers, 27, Richmond, first degree wanton endangerment

Robert Coney, 27, Rich-mond, public intoxication of controlled substance

Katreena McKenzie, 28, Richmond, operating mo-tor vehicle under the influ-ence of alcohol or drugs, failure of non-owner op-erator to maintain required insurance

February 25Aaron McCarter, 21, Mt.

Vernon, failure to appearWilliam Murphy, 23,

Richmond, public alcohol intoxication

Jeremy Roberts, 28, Berea, first degree pos-session of controlled sub-stance, prescription of controlled substance not in proper container, public intoxication of controlled substance

Jason Adams, 34, Slemp, public alcohol intoxication

Sonoa Neville, 32, Rich-mond, first degree pos-session of controlled substance, third degree possession of controlled substance, illegal posses-sion of legend drug, buy/possess drug parapherna-lia

Jessica Dargavell, 29, Winchester, non payment of fines

Conor McCaffery, 28, Richmond, failure to ap-pear

Gerrie Bailey, 24, Rich-mond, probation violation, giving officer false name or address

David Fox, 47, Beat-tyville, failure to appear, contempt of court

Johnny Vickery, 42, Rich-mond, hold for court

David Damron, 56, Pikeville, hold for court

Rachel Douglas, 35, Rich-mond, contempt of court

February 26Austin Harp, 31, Nicho-

lasville, operating motor vehicle under the influence of alcohol or drugs

George Jones, 51, Rich-mond, public alcohol in-toxication

Lois Renfro, 57, Rich-mond, operating motor ve-hicle under the influence of alcohol or drugs

Jonathan Todd, 32, Rich-mond, violation of condi-tions of release

Christopher Little, 20, Richmond, serving time

Jason Witt, 39, Waynes-burg, failure to appear

Chad Trumps, 28, Bent Harbor, Mich., hold for other

Wally Foreman, 46, tran-sit prisoner, hold for other

Willy Carcamo, 34, tran-sit prisoner, hold for other

Curt Royal, 44, transit prisoner, hold for other

Allen West, 33, transit prisoner, hold for other

William Strife, 38, Berea, probation violation

Marc Manning, 28, tran-sit prisoner, hold for other

Oris Phillips, 41, transit prisoner, hold for other

Terry Vorhies, 52, transit prisoner, hold for other

Jessica Estes, 31, Berea, contempt of court, proba-tion violation

Curtis Jackson, 36, Berea, fugitive from another state

Michael Smith, 42, tran-sit prisoner, hold for other

Christian Budniewski, 19, transit prisoner, hold for other

Vickie Gibson, 41, Tyner, violation of conditions of release

David Faircloth, 40, tran-sit prisoner, hold for other

Dennis Perkins, 25, tran-sit prisoner, hold for other

Erica Gabbard, 24, Rich-mond, theft by unlawful taking – shoplifting under $500

Regina Bellamy, 39, Rich-mond, theft by unlawful taking

Kristen Cates, 27, Rich-mond, contempt of court

Amber Noland, 31, Waco, failure to appear

Somer Brown, 25, Waco, failure to appear

Aaron Martinez, 37, Richmond, non payment of fines

Conner Haus, 20, Berea, receiving stolen property under $500, theft by decep-tion – include cold checks under $500

Canie Lowery, 35, Rich-mond, contempt of court, non payment of fines

Property Transfers for Madison County

$200 offAny Jasper Unit

including Engines and Transmissions

00859-986-3301222 E Haiti Rd.

COPE’S Garage

50th

Year!

KYANAGIANT

INDOORSWAP MEET

100 Space CAR CORRAL!CASH AND PRIZES

to be given away Daily in Broadbent ArenaAdmission: $10 per day

Children under 12 Free With a Parent

7 Acres • 1100 Spaces Inside Heated & Air Conditioned

www.kyanaswapmeet.info

For more info:Perry Probst 502-619-2917

Chester Robertson 502-619-2916

Saturday March 12th • 8:00 AM to 6:00 PMSunday March 13th • 8:00 AM to 4:00 PM

Kentucky Exposition Center Louisville, KYPavillion, West Wing & Broadbent Arena

• Free Estimates• Insurance Claims Welcome

ANGLIN’SBODY SHOP

“When you’ve been to the rest, come to the best.”

Collision, Repair & Painting

US 21 West, Berea(2 Miles from I-75)

986-2492

As I was sitting in an amaz-ing and exciting meeting this week with Dr. Chris Green, Director of the Loyal Jones Appalachian Center at Berea College, it struck me how much Berea is like the Madison County Public Li-brary. Even though I go to work at the library every day, walk countless steps around the buildings, sign off on every bill for every book that’s or-dered to fill the shelves, still, every day I discover some new gem of a book I can’t wait to read. And Berea is like that for me. Case in point: I can’t tell you how many times I have driven by the building,

parked in front of it, even taken my nieces and neph-ews in for after school tutor-ing, but yesterday was the first time I was in the Loyal Jones Appalachian Center. And it blew my mind. What a gem right in the heart of Berea! The moment I walked through the doors, I was immediately hooked. From the famous Dolly Par-ton pinball machine to the massive relief map of the Appalachian Mountains, to the colorful, exquisite, packed-with-information displays, I couldn’t get enough. Dr. Green is a big part of the appeal as well. Dur-ing our whole meeting, his smile and enthusiasm never dimmed. We were there to plan our commu-nity celebration of the work created by Madison Coun-tians as part of Kentucky Poet Laureate George Ella Lyon’s “Where I’m From: A Poetry of Place” project that is collecting poems from all 120 Kentucky counties this spring.

It was Dr. Libby Falk Jones, BC English professor, who brought us all together for this meeting. Last fall, some of her creative writing stu-dents collaborated with stu-dents in dance and graphic design to create these won-derful multimedia “Where I’m From” performance pieces. As she and I were talking about the project and the community celebration, she asked, “What about the Appalachian Center?” It was a perfect suggestion. After our meeting wrapped up, Dr. Green gave MCPL Adult Program Coordina-tor Athena Gentry and I the grand tour. I must say, I did not want to leave the Faber Library and those beautiful shelves flush with the rich-ness of Appalachian writ-ing. But he urged us onward and upward to meet the tal-ented Chris Miller, Associ-ate Director and Curator for the center, and the creative mind behind those amaz-ing displays, who gave us a tour of the archived col-

lection housed in a climate controlled room for preser-vation. Athena and I were like kids in a candy shop, exclaiming with delight over the trea-sures carefully cataloged and archived there. The rows of tiny leather boots, shelves of iron cooking pots, and rolls of vintage textiles – it was sheer joy. One of the things I love about Berea is the continual pleasure of discovery. Yes, I had visited the old Appa-lachian Center as part of an Appalachian Studies class some 25 years ago. And I have been a huge fan of Loyal Jones for decades. But it was just this week that I made this new discovery of a place that celebrates his years of work with the cen-ter. As I explored the Center’s website, my joy of discov-ery deepened. So many of my favorite programs are part of the Center – Grow Appalachia and the Brushy Fork Institute, Appalachian Heritage Literary Journal,

and the Celebration of Tra-ditional Music. And the Associated Faculty – wow! Silas House, Crystal Wilkinson, bell hooks, and Chad Berry – such a wealth of talent and resources for the campus and the commu-nity. I encourage you to check out the Loyal Jones Appala-chian Center and discover all that it has to offer. It is located in Stephenson Hall, 205 North Main St., close to the Chestnut Street intersec-tion. And I hope you will join us on April 11 at 7 PM at the Center for “Madison County, Kentucky’s Where I’m From: A Poetry of Place” celebration. In the meantime, the Madi-son County Public Library in partnership with Sustain-able Berea, the Berea Neigh-borhood Food Project, Grow Appalachia, and others, is presenting an exciting new monthly gardening series on the third Tuesday of each month at 6:30 PM. This month’s session on March 15 is extra special,

as we will feature Lisa Hil-genberg, Horticulturist at the Chicago Botanical Gar-den’s 3.8-acre fruit and veg-etable garden that last year produced 3 tons of fruit and vegetables. Lisa will be presenting a session at 10 AM at the Richmond library branch that day and 7 PM at the Berea branch that eve-ning. The evening session is actually a “double-header,” with the very popular “Ap-palSeeds Heirloom Seed Starting Workshop” at 6 PM that evening in Berea. The AppalSeeds workshop will be held at the Richmond branch on March 17 at 6:30 PM. Separate registration is re-quired for these events, and you can register through the “Events Calendar” on the li-brary’s website, www.madi-sonlibrary.org . There are lots of exciting activities happening at the Madison County Public Li-brary, and I hope I will see you here soon!


Shelf Notes

Ruthie Maslin,

Madison Co. Library

Berea is much like the Madison County Public Library

Madison County Public Library

Calendar of EventsBerea location

Berea319 Chestnut St.Berea, KY 40475P. 859-986-7112F. 859-986-7208

Richmond507 W. Main St.

Richmond, KY 40475P. 859-623-6704F. 859-623-2032

www.madisonlibrary.org

Check us out on Facebook for even

more up-to-date information!

A. Haney to Freida Mae Curry, 954 Southern Hill Drive, south of Richmond, $154,200

Donald Thomas, Judy Thomas to Thomas Family Investments LLC, Lot 11, Robbinswood Subdivision in Berea, capital contribu-tion

Donald Thomas, Judy Thomas to Thomas Family Investments LLC, Tracts in Richmond, capital contri-bution

Bryan D. Thomas, Holly Thomas to Thomas Family Investments LLC, Lot 37, Robbinswood Subdivision in Berea, capital contribu-tion

Ronald Dayne Turpin, Patsy R. Turpin, Teresa Roxann Grant, Alex Grant, Donald Wayne Turpin to Almeida A. McNelly, Earl McNelly, Tracts in Rich-mond, $93,300

George H. Lillis, Susan Lillis to Alfred E. Winkler, Brandyn L. Winkler, Tracts, Mule Shed Lane, $60,000

John Clay Howard, Amanda Baldwin, Yvonne Baldwin to Daniel Blake-man, Jennifer Blakeman, 211 Stratford Drive in Rich-mond, $123,000

Carolynn B. Lowry Re-vocable Living Trust, Car-olynn B. Lowry, trustee to Kenneth H. Ledford, Julie A. Ledford, 134 General Cleburne Drive in Rich-mond, $172,500

Douglas L. Carter to Paul M. Fraim, Teresa S. Fraim, 117 Mockingbird Hill Drive, $162,000

City of Berea to Orville Webb, Donna Webb, north-erly side of Glades Road in Berea – Parcel A, exchange

of propertyOrville Webb, Donna

Webb to City of Berea, northerly side of Glades Road in Berea – Parcel B, exchange of property

Sherry Rigney, Sherry McKinney, James D. Allen to Jeffery Thomas, Sierra Thomas, property near Waco, $105,000

Combs Colt LLC to So-nya K. Richardson, Da-vid Richardson, Lot 9, Stoney Creek Subdivision, $139,900

Georgia L. Brumfield to Michele Page, Tract in Madison County, $275,000

Yvette Kelly, Yvette Mar-cum, Gary G. Kelly to KBR Investments LLC, Lots, Clarksville Subdivision, $46,500

Dustin Riddell, Leslie Riddell to Edward Mar-shall, Tabitha Marshall, property on west side of Tates Creek Road, $37,000

Indigo Run Inc. to Brian Scott Adams, Doreen Ad-ams, Lot 22, Indigo Run Subdivision, $40,000

BHS Real Estate LLS to Jade Rental LLC, multiple properties in Madison County, $2,980,000

Joyce Fields to Kellie Mi-chelle Lake, Larry Lake, property on north side of Herndon Dirt Road, gift from parents to child

Dennis G. Macklin, Sar-ah D. Macklin to Willie E. Palmer, Rebecca B. Palm-er, 112 Seven Oaks Drive, $289,000

LP Construction LLC to Zachary T. Reece, prop-erty on east side of Oakley Wells Road, $195,528

Russell E. Riding to An-thony W. Estep, Bethany C. Estep, Lot 76, Boones Trace Subdivision, $345,000

Brian Woolwine, Jessica Woolwine to Joseph Jared Sparks, 135 Norton Drive

in Richmond, $163,500Jee properties LLC to

Commonwealth of Ken-tucky Transportation Cabinet Dept. of High-ways, Deed of Easement – Tracts on east side of US 25, $73,150 (US Widening Project)

Lucille Reed to Jeff Campbell, Tract on Scaf-fold Cane Road, $72,000

Philip A. Smith, Stepha-nie L. Smith to Mark Elder, Lindsey Elder, Lot 139, Shiloh Point Subdivision, $365,000

Buddy Cotton, Bran-don Edward Kelley, James Edward Kelley, executor, Lorine Kelley Estate, She-lia Faye Kelley Cotton to James Edward Kelley, 101 Chris Drive in Richmond, $50,000

Foley Development Inc. to Aaron Stidham, Tracy Ann Stidham, Kenneth Cornelison, Patricia Cor-nelison, 1064 Amberly Way Drive in Richmond, $187,400

Charles K. Givens, Lauri Givens to Jeffrey B. Selby, trustee, J & B Living Trust, Tracts by waters of Ken-tucky River, $280,000

Robert A. Ison, Leah B. Ison to April Michelle Poe, Lot 30, Meadowbrook Sub-division, $124,500

Dewayne K. Richards, Kimberly J. Richards to Rodger K. Mason, Robin R. Mason, Tracts, Walnut Meadow Road, $143,000

Mary E. Oldfield, James S. True to John David Stipes, Harriet Stipes, Lot 19, College Park Subdiv-sion – on Barnes Mill Road near Richmond, $120,000

Frank Moore, Cherie Moore to Phillip Nipper, Haleigh Nipper, Lot 200 Creekside Village in Berea, $121,200


PROPERTYCONTINUED FROM B2

Reflections FROM THE BEREA CITIZEN ARCHIVES MARCH 1966

Berea Community stu-dents on the honor roll in March 1966 in 11th grade were Frank Anderson, Rie-ta Botkin, Bruce Ballinger, John Fowler, Carl Hazel-wood, Steve Kiteck, Terry Simpson, Jerry Tull, Con-nie Van Winkle, Larry Wy-att, Barbara Tomlin, Albert Scruggs, Danny Hudson and Richard Johnson.

Seniors in the honor roll were Sandi Cain, Sue Clark, Linda Coyle, Shirley Devere, Audry Dinwid-die, Jimmy Evans, Lenora Johnson, Lana Lunsford, Sharon Miracle, Patti Pet-ters, Diana Pigg, Betty Sue Rose, Glenna Rowlette, Paulette Wyatt and Anga

Lee Jennings.Babies born were Di-

ana Lynne to Roy and Eva Baldwin; Tony Edwin to Donald and Shirley Monk; Jenny Lamia to Wilburn and Cleta Chasteen; Clif-ton Vermillion to Edward and Eva Juanita Daugh-erty; Kathy Christene to Vernon and Nora Irene Graves; Gerald Clark to Gerald and Joan Carol Jones; and Teresa Faye to Barney and Dorothy Alex-ander.

Some people selected for jury duty at the Madison County Circuit Court for the February-March term in 1966 were Jennings B. Rymell, William Jackson,

Amos Stephens, Dale Rice, Esco Baker, Clifford Baker, Mrs. Lawson W. Hamil-ton, James P. Todd, Wil-liam P. Kindred, Flemon Kirby, Mrs. W. T. Bush, Claude Duncan, Orville Abner, Park Fike, Joanne Allen, Cecil Barclay, Rus-sell Howard, Coleman Broaddus, Nellie Blan-ton, Fred Jones, Robert M. Grigsby, Ralph A. Cuzick, Mrs. Curtis Parke, Neville Chowning Todd, Mrs. N. B. Deatherage, Mrs. Mar-querite Abney, Noland Bogie, Mrs. Arch B. Clark, William A. Hughes, Ray Estes, Mrs. L. M. Oliver, Bobby H. Croucher, and Phillip Sowers.

Med Save Pharmacy is pleased to welcome

David Fligor

DISCOUNTPHARMACY

WelcomeDAVID

Check out our Dollar Wise Section of Health & Beauty and Cleaning Products!

• REPUTABLE • RELIABLE • TRUSTWORTHY

102 Prince Royal Drive 859 985-7283

We Offer• FREE Vitamins • Compounding

• Vet Meds• Diabetic Shoes

• Free local deliveryand so much more!

David, formerly with Rite Aid, has been a practicing pharmacist in Berea for more than 28 years. As an independent hometown pharmacist, he looks forward to helping you with your prescriptionsand other health care concerns.

American Association of University Women, Berea

25th Annual Authors Brunch & Silent Auction Saturday, March 19, 2016 10:00am– 12:30pm

Coyle Gathering & Lincoln Rooms, Boone Tavern - 100 Main St. Berea

Photo credit Jennifer Munson

Charles Bracelen Flood

& daughter Lucy Flood

Tickets are $25 and can be purchased from Wednesday, March 3 - Thursday, March 17 Call 859-623-5832 or email [email protected]

AAUW’s Mission and Diversity Statement The American Association of University Women promotes equity for all women and girls, lifelong education and

positive societal change. In principle and practice, AAUW values and seeks a diverse membership. All proceeds go toward scholarships for women.

Honored as Kentucky Poet Laureate for 2015-16, George Ella Lyon is on a mission to find a poem from every county in her project “Where I’m From.” Lyon first began writing poems in elementary school. While attending Centre College in Danville, Kentucky she dis-covered that writing was what she loved most during her study of English and music. Her love for music and words have been an inspiration to many as she teaches the impact and power that words have in expressing and connecting the hearts of both readers and writers.

“Though I write in many forms, I am first of all a poet; which means my job is to see and sing the connections between things. The spider’s web is a delicious image for this and for the wonder of something newly made from old patterns, like the sentences writers spin each day. The strength of my web comes from family, friends, words, music, dreams, mountains, and the joy of making. Think about the life you are spinning and how you could write about its different strands. “

George Ella Lyon

Charles Bracelen Flood was the author of fifteen books, many of which were critically acclaimed, including Lee: The Last Years and First to Fly: The Story of the Lafayette Escadrille. He wrote a number of books on historic figures, including Robert E. Lee and William T. Sherman. His short pieces were published in magazines, including The New Yorker, The Atlantic and Esquire. The Washington Post had this to say about Grant and Sherman– The Friendship That Won the Civil War, it was “beautifully defined and explored… a powerful and illuminat-ing study of the military collaboration that won the war for the Union.” “Mr. Flood’s versatility is impressive…” wrote New York Times Janet Maslin.

Flood graduated from Harvard and was a member of Archibald MacLeish’s noted creative writing seminar. He was a past president of PEN America Center and served on the governing bodies of the Authors League and Authors Guild. Flood was born and raised in New York City, spending much of his life there. Much later in life he lived with his wife, Katherine, in Richmond, Kentucky until his death in 2014.

Lucy Flood will be presenting works of her late father Charles Bracelen Flood. She is an editor specializing in helping writers and art-ists ignite their creative fire, and write from the heart of their artistic inspiration. She lives with her husband in the Bay Area and enjoys writing at dusk on the patio of her favorite creek-side café. One thing she misses about Kentucky is watching fireflies flash against a dark sky. She is the author of the forthcoming novel The Way Minnows Kiss.

Sarah I. Little, MD, and Stephanie Napier, APRN

BAPTIST HEALTH MEDICAL GROUP

BaptistHealthMedicalGroup.com

Appointments: 859.985.2656

FAMILY MEDICINE

Nurse Practitioner Stephanie Napier, APRN, has joined

Baptist Health Medical Group

Family Medicine. She is accepting

new patients, age 2 years to adult, for

general health needs, including

acute care, chronic illness,

physicals and immunizations.

295 Paint Lick Road, Berea, KY 40403

Sarah I. Little, MDStephanie

Napier, APRN

Stephanie Napier 5.5x10.5 Ad.indd 1 2/22/16 1:12 PM

THURSDAYMarch 10,

2016Vol. 116, Issue 40


Inside





Our Staff

Teresa Scenters,

Publisher

Beth Myers,

Editor

Kim Kobersmith,

Critley King

Reporters

Keeley Johnson,


Sheila Johnson,

Advertising

Timothy Pack,

Graphic Design

50¢ Newsstand

Plac

e m

ail l

abel

her

e

Contact Us



Ph:859-986-0959Fax: 859-986-0960


B1



Art fellows from Gallery 123 show at

Kentucky Crafted

Chamber, City Lock Horns Over

Spoonbread Festival

By Critley KingCitizen Reporter

Recently, the City of Berea said “Hello” to Luna Zorro, a new art gallery and store located on Chest-nut St. that according to owner and artist Kayla Harned is all about Appa-lachian themes and being resourceful.

Harned explained that the whole gallery is based around light and how it fuels the earth, plants, and animals. The store slogan is, “Let the earth fuel you and the light guide you.”

“All of it (the art) has a Kentucky feel and all pieces are uniquely made,” said Harned, who has a strong connection to Ken-

tucky and Berean roots, having lived here since second grade.

Harned said she began wanting to open a gallery after attending EKU as an art education major. She wanted to teach children art, but in a different way than she has seen.

“Art had really helped me in my path and in dis-covering things,” said Harned. “It helped me look at the world in a bet-ter way.”

Harned then switched her focus to printmaking.

The idea behind Luna Zorro began at the Spoon-bread Festival, where Harned and her fiancé/business partner Tim Hard-ing had a booth. Around

the same time Harned and Harding were looking for an apartment in Berea and happened upon 408 Chest-nut St.

“I just saw all the poten-tial,” Harned said.

In the folksy yet hip feel-ing space, visitors will find a wide variety of artistic medium and experiments.

“I do up-cycled jewelry with copper,” said Harned. “Of course the main focus here is printmaking. It is a traditional art that I love. There are also paintings, and pillow making.”

The couple forwent other jobs to focus on their start-up, with Harded mainly doing the drawings and conceptual production and


Mitchell Tolle prints, Tater Knob pottery, fair trade crafts, old fashioned candy . . . these are only some of the new items Bereans can expect at the rebranded and re-envi-sioned gift shop of Dinner Bell Restaurant.

The official presenta-tion of this new Berea

gift store will take place next month, at the open house on April 8 from 5 – 8 p.m., and will include not only the unveiling of a brand-new Mitchell Tolle painting, but also a give-away of a clay bell crafted by Sarah Culbreth of Tater Knob. Charles and Marilyn Arnold, who purchased the Dinner Bell several months ago, envi-sion this new store as an-

other gateway into the arts and crafts heart of Berea.

“This is a bit out of our realm,” Charles said, “but we’re having loads of fun.”

The Arnolds have owned and managed the Berea Subways since they were first built, but this is their first foray both into restauranting and retail.

SEE GIFTS, PAGE A12

SEE LUNA, PAGE A12


The ancient conflict between independent, private enterprise and governmental regulation has sprung up this past week in Berea over what is fast becoming one of the biggest annual events in town – the Spoonbread Festival.

Both conventional me-dia and social media have been hot the last several days, as people weigh in on the issue of whether the City of Berea should or could require the Berea Chamber of Commerce to screen the merchan-dise that is sold by their vendors at their signa-ture fall festival. The par-

ticular item the city wants screened out– the Con-federate battle flag – has brought even more heat to the conflict.

“I’m afraid the media frenzy is creating a bigger issue out of the Confeder-ate flag than it really is,” Jennifer Napier, the presi-dent of the Berea Cham-ber said. “The flag has be-come the pawn in this. It’s really about our concern with government control over a private entity.”

In the past, the City of Berea has issued a two-page contract to the Chamber for the Spoon-bread Festival, outlining the guidelines for spend-ing the $5,000 grant they have received annually

Dinner Bell Gift Shop to Sell Local Art & Fair Trade

SEE HORNS, PAGE A12

Mitchell Tolle Jr., or “M.J.” works with Charles Arnold’s staff to teach them how to

frame his father’s work. Left, Hezekiah Weiss works on a

frame. Mitchell Tolle’s prints will soon be sold at the Dinner Bell

gift shop, which Charles and his wife, Marilyn, have rebranded

and re-envisioned. They will be holding an open house for the shop on April 8 from 5 - 8 p.m., where Tolle, Sr., will unveil his newest painting. They will also be selling Tator Knob pottery,

arts and crafts from Gallery 123, fair trade art, and Warren

Brunner’s books.

Library, Sustainable Berea Partner on Gardening Series


Maintenance of coun-ty roads became a topic at the Madison County Fiscal Court meeting in Berea on Tuesday, when Magistrate John Tudor ex-pressed concern about the heavy trucks that were tearing up Hunter Lane.

“I’m wondering if there’s something we can do, require them to bond the road or something like that, because we have to keep repairing them as they are torn up,” Tudor said.

Magistrates Roger Barg-er and Larry Combs said they remembered con-sidering putting weight

limits on trucks years ago, but that was for subdivi-sion roads.

Judge Reagan Taylor pointed out that if they were going to put weight limits on county roads, there could be an expense to the county.

“What’s the cost to get an engineer out here to do an estimate,” Taylor said. “We need to check into that. But we’re all in agreement that we need to look into it.”

Magistrate Tom Botkin asked the public to help the recent epidemic of road signs being stolen or vandalized by keeping their eye out and calling

Fiscal Court Discusses Trucks on County Roads

Luna Zorro Opens on Chestnut


Gardeners and wan-nabes have an opportu-nity to learn from an ex-pert next week.

The Berea Library and Sustainable Berea are collaborating on an edu-cational workshop series called “How Does Your Garden Grow?” The se-ries will kick off March 15 at the library with Lisa Hilgenberg, horticultur-ist at the Chicago Botanic Garden’s 3.8-acre Regen-stein Fruit & Vegetable Garden.

Titled “Urban Garden-ing: Make the Most of the Space You Have,” Hil-genberg will share about site selection, soil health, starting seeds, informa-tion on growing specific vegetables, and making the most of your square footage.

Hilgenberg has veg-etable gardening in her blood: her family’s Cen-tury Farm heritage dates

to 1881. In 2015, the Re-genstein Garden’s 55,000 plants produced a har-vest of three tons of fresh fruits and vegetables.

She grows everything from herbs to fruit trees, and according to Chey-enne Olson with Sustain-able Berea, it is beauti-ful as well. “Espaliered apple trees grow against walls, lettuces grow six feet up in boxes, and foods and flowers wrap in circles.”

The information will be adaptable to all sizes of gardens. The library asks that people make reservations for the class on the website at www.madisonlibrary.org or by phone at 859-986-7112.

Other classes in the series will be held on the third Tuesdays. The April 19 class on plant-ing raised beds will be hands-on at the Berea Urban Farm. It will cover how to transplant, when

SEE GARDEN, PAGE A11

SEE COUNTY, PAGE 11

C O M M I T T E D T O C O M P A S S I O N A T E S E R V I C E

©20

13 M

KJ M

arke

ting

“At those difficult times, we believe giving you our very best is the

very least we can do.”

When you need a hand to hold, an ear to listen, or a shoulder to lean on, we will be here for you.

“We’re here for you always...”616 Chestnut Street • Berea • 859-986-3115 • DavisandPowellFuneralHome.com

Left to right: Leonard Bratcher, John S. Walker, Jr., Marian Abbott, Greg Powell, Jim Davis


Reppert Funeral Homea n d C r e m a t i o n S e r v i c e

110 N. Broadway, Berea, Ky 40403 • 859-986-3165

Traditional Services, Direct Cremation,Visitation/Funeral Same Day Services,

Entombment, Grave Side Services, Memorial Services, Green Burials, Preneed Options.Green Burials, Preneed Options.

www.reppertfuneralhome.com

Located in Historic

Old Town

Donald Ambrose

Kyle Edward Bowman, 32, of Mt. Vernon, died suddenly Sunday, March 6, 2016. He was born March 26, 1983, and was a self-employed mechanic.

Kyle attended Berea College and Eastern Kentucky University. He loved sports, and was an avid and loyal fan of the Green Bay Packers and Notre Dame Fighting Irish. He lived in Rockcastle and Madison Counties most of his life, and faithfully attended Church on the Rock.

Survivors include his mother, Carol (Lynn) Vaughn Abrams; his father, Edward “Mickey” Bowman; fiancée, Nikki Slone; four children, Emaleigh Jayde Bowman, Brodye Asher Robin Bowman, Raiden Slone, and Bella Slone; two siblings, Bryan Douglas Phillips and Kelley (John) Lynne Wendel; as well as a host of relatives and friends. He was preceded in death by one sister, Tracy Leigh Phillips.

Memorial service will take place at 2 p.m. on Saturday, March 19, 2016 at Reppert Funeral Home, with accep-tance of friend at 12 p.m. The graveside committal ser-vice with burial of cremains will take place at 3 p.m. on Sunday, March 20, 2016 at Davis-Witt Cemetery at Scaf-fold Cane in Rockcastle County. Reppert Funeral Home and Cremation Service entrusted with arrangements.

Donald Ambrose, 71, of Mt. Vernon, died Sunday, March 6, 2016 at U. K. Medical Center in Lexington. He was a lifelong resident of the Scaffold Cane section of Rockcastle County.

Donald was born on July 6, 1944, son of the late James Robert and Less Croucher Ambrose. He was a farmer, and property owner. He attended Grace Baptist Church.

Survivors include one sister, Ellen Ambrose; one sis-ter-in-law, Roxie Ambrose; one brother-in-law, David Coffey; and numerous nephews, nieces, great-nephews and great-nieces, relatives and friends. In addition to his parents, he was preceded in death by seven siblings, Bessie Bargo, Carlouse Ambrose, Eva Ambrose, Thursie Ambrose, Mary Coffey, William Ambrose, and Wayne Ambrose.

Graveside service took place at 1 p.m. on Wednesday, March 9, 2016 at Scaffold Cane Cemetery with Bro. Ray-mond Offutt officiating. In order to carry out Donald’s wishes, no visitation was scheduled.

Jean Clark Engle

Jean Clark Engle of Berea died on Friday, March 4, 2016 at The Ter-race in Berea after a long illness. She graduated from Berea Foundation in 1943 and from Berea College in 1947.

Jean retired from The Richmond Register after 36 years of reporting Berea news. She also worked for WEKY doing the Berea news from her home via the telephone from Monday to Friday through 1976. In addition, Jean was a contributing writer for the Lexington Leader from 1960-1983. She also worked with WKXO in Berea as a reporter.

Jean loved people, and being a reporter was never bor-ing. It was exciting to make wonderful new contacts and meet exciting people from all walks of life. One of her fa-vorite activities was writing feature stories about excep-tional and interesting Bereans, as well as famous people who were guests of Berea College convocations. She enjoyed being a reporter because she could do it from home while enjoying being there for her three children.

Known for her warm and charming personality, Jean often took flowers she grew to shut-ins or people in the hospital and nursing homes.

She was preceded in death by her parents, William and Ruth Clark; and her husband of 55 years, Jack W. Engle.

Jean is survived by her children, Joan E. Keith and her husband, James Lee Keith; Judy (Tim Hiscock) E. Gro-leau, and Jack C. Engle; seven grandchildren, Joseph Keith, Krista Lewis, Christopher Groleau, Kelley Grole-au, Megan Groleau, Jessica Engle, and Justin Engle; and two great grandchildren.

Services took place at 3 p.m. on Monday at Davis & Powell Funeral Home with Revs. Mark and Lisa Cardwell-Reis officiating. Burial followed in the Berea Cemetery. Jean was a member of First Chris-tian Church where expres-sions of sympathy may be made to the Building Fund of First Christian Church 206 Chestnut Street, Berea, Kentucky 40403. www.da-visandpowellfuneralhome.com

Robert Eugene Lake

Kyle Edward Bowman

Robert Eugene Lake, 86, passed away on Thursday, Feb. 25, 2016 at Richmond Health & Rehab-Ken-wood.

Robert was born on June 19, 1929 in Madison County, and was the son of Boyd Wagers Lake and Marie Gentry Lake, both of whom preceded him in death. He was a retired assembly line supervisor with IBM, and a farmer and National Guard member. He loved his family great-ly, and was of the Baptist faith.

Survivors include his wife, Russie Frazier Lake; three daughters, Gloria (Hugh David) Cain of Berea, Phyllis (Ronald) Rose of Richmond, and Mary (Eldon) Lynn Campbell of Berea; five grandchildren, Andrea (Kevin) Harreld, Edwin (Bobbie) Cain, Allen Rose, Adam (Shan-non) Rose, and Dustin (Cara) Busler; five great grand-children, Annalee Harreld, Grayson Harreld, Natalie Harreld, Lilyan Cain, and Emory Joyce Busler; and one sister, Betty (Ray) Lake Bernardi of Lexington.

Funeral services for Robert Lake were conducted at 1:30 p.m. on Monday, Feb. 29, 2016 at Oldham, Roberts & Powell Funeral Home with Bro. Kenny Davis and Da-vid Frazier officiating. Burial followed in the Richmond Cemetery.

Pallbearers were Adam Rose, Dustin Busler, Edwin Cain, Kevin Harreld, Paul Frazier, and David Frazier. Honorary pallbearers were Allen Rose, Algan Lake, Robert Martin Lake, Collis Setters, Dwight Evans, and Mickey Lutes.In lieu of flowers, memorial donations are suggested to one’s favorite charity.



00859-986-3301222 E Haiti Rd.

COPE’S Garage

Medicare SupplementAge 65-66-67 N/T PLAN “F” PLAN “G”MALE 133.67 106.67FEMALE 116.58 92.92

Call For Rates Age 68-100

Whole Life • Burial Insurance* Guaranteed Issue *$10,000 AMOUNT

AGE 50MALE $24.50 ~ FEMALE $18.70

Call For Rate Age 0 To 85JAMES I. MILLER 859-582-7421

Mabel Lake Hayes, 81, widow of John Smith Hayes, died Friday, March 4, 2016 at the UK Medical Center in Lexington. She was born in Cartersville to the late Jake and Ella Allen Lake. Mabel was retired from Gibson Greeting Cards. She was a former board member of the White House Clinic, and a member of the Berea Baptist Church.

Mabel was preceded in death by her parents; her hus-band; and her siblings, Irene Lake, Bessie Mae Lake St. Clair, Lorene Lake Green, and Donald Lake.

Mabel is survived by her children, Jim (Donna) Hayes of Lexington, Randy Hayes of Somerset, and Laura (Randy) Carpenter of Berea; her brothers, John (Nancy) Lake and Gary (JoAnn) Lake; her brother-in-law, Jerry Hayes, and sister-in-law, Lorraine Lake; her granddaughters, Leslie and Sarah Carpenter; and nu-merous beloved relatives.

Funeral services were Tuesday, March 8, 2016 at 11 a.m. at Lakes Funeral Home with Rev. Bill Fort offici-ating. Burial was in the Berea Cemetery. Pallbearers were Nathan Lake, Ethan Lake, Austin Baker, Ryan Baker, Rick Hayes, Garrett Powell, and Hunter Wil-son. Honorary pallbearers were John Johnson, Scott Crane, Mike Lake, Bill Lake, Ronnie Carpenter, Scott Lake, Jake Lake, Jon Lake, Ben Lake, Jared Lake, Bill Green, Bob Green, and Jim Green. Online condolences at www.lakesfuneralhome.com.

Ray “Capt. Ray” Lewandowski passed peacefully at the VA Hos-pital on March 6, 2016 in Lexing-ton at the age of 78 after a short bout with cancer.

Ray is survived by his loving wife, Diane of Berea; a brother, Don Lewandowski of Orland Park, Ill.; a sister, Dolores Wasylik and her husband, Ed Wasylik of Frankfort Ill.; a son, Ray, Jr., and daughter-in-law, Emily of Dublin, Ohio; and grandchildren, Ray III, Alex, and Lucy.

Ray was born on November 7, 1937 in Chicago to Alex and Marie Lewandowski. He married Diane, the love of his life, in 1962 after spending four years serving his country as an aircraft mechanic in the United Sates Air-force. During his time in the air force, Ray was intro-duced to the other love of his life, flying.

After being discharged from the USAF, Ray began to fly, and to pursue the dream of being an airline pilot. He began his lifetime dream of being an airline pilot in 1966 when he joined Eastern Airlines. The culmination of that dream was achieved on January 9, 1984 when he became a captain for Eastern and was given the nick-name, “Capt. Ray” a name he was known by the rest of his life.

Ray and Diane retired to the Berea area, and Ray was a greeter at the Berea Tourism Welcome Center.

A memorial service is scheduled for Saturday, March 12 at 11 a.m. at St. Clare Catholic Church in Berea, with a reception to follow at the Friendship Hall. Father Michael Flanagan will officiate the ceremony. All are welcome to attend and celebrate Ray’s life. The family would like to thank the doctors, nurses and staff at the VA Hospital in Lexington for their care, compassion and efforts in Ray’s last days.

Ray “Capt. Ray” Lewandowsky Mabel Lake Hayes

Rebecca Kay Greenwell, age 54 of Berea, passed away Tuesday, March 8, 2016.

Visitation will be on Friday from 5 to 8 p.m. at Davis & Powell Funeral Home in Berea with a Funeral Mass at St. Clare Catholic Church on Saturday at 2 p.m., with a reception following. Davis & Powell Funeral Home is in charge of the arrangements. In lieu of flowers, the family ask that donations be made to the Compassion-ate Care Center in Richmond. A full obituary is avail-able on line at davisandpowellfuneralhome.com and will be printed in next week’s Berea Citizen.

Rebecca Kay Greenwell


Criminal Mischief• On March 1, officers were called to Knight’s Inn be-cause of property damage. An employee reported that someone damaged a room before checking out. The estimated loss was $150.

Wanton Endangerment• On March 1, officers were called to Walmart because of a suspicious vehicle in the parking lot. The police found the driv-er passed out behind the wheel, with a small child in the vehicle. A woman who was a relative of the child was inside of store. Both adults showed signs of intoxication. The driver had hydrocodone tablets and xanax tablets in his pockets, along with an empty syringe. Officers ar-rested Patricia Mays, 46, of Berea and Kerry Seaborn,

53, of Berea. They were both charged with second degree wanton endanger-ment and public intoxi-cation. Seaborn was also charged with first degree possession of controlled substance, third degree possession of controlled substance, and drug para-phernalia possession.

DUI/Wanton Endangerment• On March 1, officers were called to the area of Sil-ver Creek Elementary be-cause of a vehicle collision. The driver of the vehicle smelled like alcohol and said he had been drinking. He also had a small child with him that had been in the vehicle during the col-lision.

Officers arrested Rebel Roser, 30, of Berea and charged him with operat-ing a motor vehicle under the influence -- first offense (aggravating circumstanc-es) and first degree wanton endangerment.

Burglary Arrest• On March 2, officers were called to the 100 block of Brown Court be-cause of an intruder inside the caller’s apartment. Of-ficers located this intruder stumbling around outside of the apartment. He was intoxicated and had fresh cuts on his hands.

The victim said the sub-ject broke out a window and entered the apartment. He then assaulted the resi-dent when a second person in the apartment wrestled the subject to the ground. Officers arrested Timothy Baker, 50, of Berea and charged him with first de-gree burglary, third degree criminal mischief, fourth degree assault, second de-gree disorderly conduct, and alcohol intoxication in a public place.

Shoplifting Arrest• On March 4, a Walmart employee saw a woman attempt to leave the store with items in her cart that she did not pay for. The total value of the merchan-dise was $146.16. Officers arrested Laquita Clark, 32, of Berea and charged her with theft by unlawful tak-ing -- shoplifting.

Theft• On March 5, a resident from the 100 block of Josh-

ua Circle reported a pack-age stolen from the front porch of the residence. The

estimated loss was $265.• On March 6, officers were

A3 The Berea Citizen Obituaries/Local News

SEE POLICE, PAGE A11

Thursday, March 10, 2016









To RSVP, Call (859) 986-2371

OPEN 9-7 MON-FRI & 9-6 SAT

286 GLADES ROAD859-986-3456

natural foodsHAPPY MEADOW

CURRENT SPECIALS

Monday, March 14th

is DISCOUNT DAYC a l l f o r d e t a i l s .

KNUDSEN ORGANIC JUST CHERRY JUICES

ANNIE’S SALAD DRESSINGS7 VARIETIES

up to

53% OFF

up to

20% OFF

2 for $1.00

SALE $2.79Your Healthy

Food & Nutritional

Center since 1972

JUSTIN’S PEANUT BUTTER SQUEEZES

SELECT ULTIMATE FLORA PROBIOTICS





FAMILY MEDICINE










Napier, APRN


Youare the

rainbowin my life.

Happy30th

BirthdayTy Ty!

Love, Auntie EmCourtley Stepp

Ira James Brock, Sr., 81, of Car-rollton, formerly of Cynthiana, died Wednesday, March 2, 2016 at Signa-ture Healthcare of Carrollton. He was a native of Garrard County.

Mr. Brock was born to the late Leon-ard Brock, Sr., and Anna Lear Brock. He was a farmer, and enjoyed spend-ing time with his grandkids, and great grandkids. He also enjoyed hunting and fishing. He was of the Holiness faith

Mr. Brock is survived by a son, Ira (Marian) J. Brock, Jr., of Cynthiana; a daughter, Linda (Rick) Bailey of Rich-mond; four grandchildren; four great grandchildren; and two step-great grandchildren. He was preceded in death by a son, Danny Ray Brock, three sisters, and one brother.

Funeral services for Mr. Brock took place at 11 a.m. on Monday at the Davis & Powell Funeral Home with Rev. Kent Allender officiating. Burial followed in the Cart-ersville Cemetery. Pallbearers were Steven Hardy, Andy Feeback, Rick Bailey, Craig Gant, Roger Soard, and San-dra Brock. www.davisandpowellfuneralhome.com

Courtley Stepp, 71, died suddenly on March 5, 2016 at his home in Berea. He was born in Owsley County to the late Richard and Bertha Barrett Stepp.

Courtley was a US Army veteran of the Korean War, and was proud of his service to the country. He was a graduate of the Owsley County High school, and a land-scaper by trade. Courtley loved to ride his motorcycle, and spend time with his family, and he enjoyed good music.

Courtley was preceded in death by his parents; his wife, Margie Stepp; his sister, Mae Stepp; and his step-daughter, Kathleen Riley.

Courtley is survived by his children, Donald Wayne Stepp and Ronald Wayne Stepp; his stepchildren, Shan-non Rutan, Mike Riley, and Patricia Hicks; his siblings, Jim and Janet Stepp of Beattyville, Vernon and Shirley Stepp of Richmond, Clarence and Bonnie Stepp of Beth-el, Ohio, Maude Evans of Mt. Vernon, Joann and Denny Cunnagin of London, and Earnest and Anita Stepp of Berea; his special friends, Sarah and Jackson Lakes; and grandson, Brian Roundtree.

Funeral services were Wednesday, March 9, 2016 at 12 p.m. at Lakes Funeral Home. Bro. Cecil Burns officiated services, and burial was in the Camp Nelson National Cemetery. Online condolences at www.lakesfuneral-home.com.

Ira James Brock, Sr.






the


Berea“Let us not be weary in well doing, for in due

season we shall reap if we faint not.” - Galatians 6:9








From our readers

What Do You Know? The photo to the right from Warren Brunner’s archives show what appears to be a crafts fair, with then Governor Martha Layne Collins and Al Smith. Can anyone identify who the other three people are, and what the local event may have been? Or have any other information to share?

Make Energy Decision Based on Facts

Response to Photo from Last Week

A few different people called in about the photo that appeared last week, of three men with one driving a

truck. The driver, according to callers, was Carl (Snake) Roberts who was driving a milk truck for Southern

Belle. It was around 1969. The two men with him were John Wayne Alcorn on the right, and Roger Jones on the left from Gabbardtown. They used to play music

together.

Dear Editor,

When, before, has a council member taken out a full-page ad in this paper for any purpose other than to seek reelection?

It was quite surprising to see councilman Jerry Little’s ad related to choos-ing Berea’s next wholesale electric power provider, a decision that is now be-ing debated. It is clear that councilman Little is either passionate about his al-ready formed decision – to go with Kentucky Utilities (KU) no matter what the facts may dictate – or he has been co-opted by oth-ers who want to see KU get the contract. Perhaps it is some of each. Just as he has shouted and belittled others in meetings about this process, he now wants to shout at the rest of the community via this paper. Is this the way to make such a critical decision on the future of our city?

A few other council mem-bers appear to be carefully evaluating the facts that are placed before them. I hope their decisions will be guided only by those facts. Other council members have been conspicuous by

their absence or apparent disinterest in THE most critical decision the council will make for many, many years. Have these council members already made their decisions without consideration of the facts? Will they just vote along with whoever shouts the loudest? Either action is unacceptable of those we’ve elected to make de-cisions for our benefit.

Reliability and cost are the most important con-siderations in a choice of electric provider. When it comes to reliability and cost, I must turn to Berea’s consultants who have a long history of working with our city evaluating these critical aspects. The consultants consider the Kentucky Municipal Ener-gy Agency (KyMEA) to be superior to KU on both cost and risk. Those who make electric power decisions for the ten cities that are currently part of KyMEA also carefully considered the alternatives and they are convinced that KyMEA is a better choice on all fronts than is KU. (Yes, they also considered going with AMP Ohio, which Mr. Little mentioned.) Some of

these cities have dedicat-ed power boards or staff whose total job is focused on the best electric power decisions for their com-munities. Is Mr. Little right and ten other cities wrong?

I have observed multi-ple KyMEA meetings and I am confident that their processes, guidelines and strategies are all robust and in the best interests of their respective communi-ties. Mr. Little has never attended a meeting, so it is possible he is acting out of fear of the unknown. It is clear from some of the things he’s said and read that KU – or some other invested party – has been feeding him their versions of the “facts.” Is that ap-propriate? Is that the way we contract for services in our city?

Contact your council members, today. Tell them you expect them to make their own, thoroughly evaluated decisions and NOT simply to listen to the loudest voice in the room. This decision is too impor-tant.

Steve WilkinsBerea

Dear Editor,

This is an open letter to Mayor Connelly and the Berea City Council:

I am writing this in re-sponse to the headlines in both the Berea Citizen and the Richmond Register. It appears to me that a small, vocal group is causing the Mayor to prepare a resolu-tion directed to the Cham-ber of Commerce which seems to threaten to cut off support for the Spoon-bread Festival. I want to let everyone know that I fully support the efforts of those leaders and volun-teers which have worked so hard to make sure we have a successful festival each year.

I have been a partici-pant/vendor in the Spoon-bread Festival for several years now. I see more and more people attending the

festival each year. The fes-tival has grown more than anyone really expected in the formative years. I would challenge anyone to find a restaurant, motel, or service station which has not benefited greatly each year the festival has been held. It has been a per-sonal benefit to me. I have enjoyed meeting many people over the years and being able to show and sell some of my craft. I can’t pay the mortgage with my sells, but I have been very happy with my sells each year.

I understand that the Confederate Flag and/or items showing the flag is the big issue. In my opin-ion, the more attention giv-en to this, the more some will want to show this silly emblem of the past. Ken-tucky was a border state, never a part of the confed-

eracy. Sure Kentuckians fought on both sides of this useless war. I had an-cestors on both sides. But that war ended long ago, and anything pertaining to it should be put in the past except as a part of his-tory books and museums. We are the United States of America, and should be proud to fly only the American flag, Old Glory.

It is my hope that ev-eryone will continue to support the Chamber of Commerce and its lead-ers, and that we will con-tinue to have a successful 2016 Spoonbread Festival. Please do not let this excep-tionally successful event come to an end by regulat-ing it out of existence.

Will BondurantBerea

Keeping a community and its members thriving


Dear Editor,

The editorial by Teresa Scenters in last week’s Cit-izen was full of name-call-ing and blaming, but sadly contained no real reliable information. Thank good-ness people were con-cerned enough to seek out other sources with better information before jump-ing on that bandwagon! I hope that the next time Scenters picks up her pen she can find a way to pro-vide factual information to support her statements. It would save a lot of people a lot of scurrying around.

I may misunderstand her intentions, but it ap-pears to me that the bot-tom line of the whole thing is that Scenters is afraid to see any change in the Spoonbread Festival, even changes that might make the SBF a safer and more friendly event for all concerned, or that might bring a new sense of in-tegrity to the situation. I gather she believes that accommodating some in-dividuals would necessar-ily trample the rights of other individuals. While I can agree that change is sometimes scary, and that sometimes in the course of change some people don’t

get to have everything their usual way, I heart-ily believe that institut-ing structure and accom-modations where they have been lacking can be positive for everyone concerned. I suspect that those holding most tightly to the tradition of the last six years or so will even-tually discover that they haven’t been hurt at all by the Mayor’s new guide-lines.

That said, in the bigger picture, I am intrigued by the relationships between communities and indi-viduals because there are so many complicating and difficult factors. How can an individual’s unique-ness be honored and uti-lized by the community to which she belongs? Who belongs to what commu-nity and by whose decree? Who doesn’t belong in a particular community and what does that mean for that individual and that community? And a very primary question in Berea these days, when the larg-er community group in-cludes a variety of smaller communities with differ-ing sets of values, how can the larger community sus-tain itself, and specifically, how can it put to good use

all of the qualities avail-able in the smaller groups so that the larger commu-nity continues to thrive?

To keep the conversa-tion going in a productive and healthy way, and to help me (and other inter-ested Bereans) come to a better understanding about these issues, I in-tend to host a two-part forum during which I will do short presentations followed by discussion. My perspective comes from a blend of deep ecol-ogy, occupational science, and spiritual traditions, which together provide a framework that I and oth-ers have found useful for solving problems. I would love for a variety of points of view to be represented at both meetings of this forum, so that as many as possible perspectives can be included in how we think about the commu-nity of Berea. This forum is on the schedule for the community room at the public library on April 10 and April 24 from 2-4 PM. Stay tuned for more infor-mation closer to that time.

Pat GaileyBerea

Please continue the Spoonbread Festival

More Letters to the Editor on A5

Publisher’s Note: I’m not sure what Ms. Gailey interpreted as name calling in the opinion piece I wrote last week. Maybe I too misinterpret her intentions, but it seems to me she is impugn-ing my integrity and without using the word, calling me a liar. Just to keep the record straight, there were no untruths in that column. None of us wants anyone to feel unsafe at the festival or anywhere else. In my mind, this edict from city hall is just another assault on First Amendment rights, and a case of political correctness run amok. We can agree to disagree.

A5 The Berea Citizen Opinions Thursday, March 10, 2016

Happy 90th BirthdayCharles Whittamore

Nobody could have had a better father, and you’ve been a wonderful grandfather & great-grandfather. Hope we’ll get to celebrate many more birthdays with you!Love, Carolyn & family

As we celebrate the 90th birthday of my dad, Charles Whittamore. I have personally reflected over the years, the wonder-ful times we have shared, and the many things he has taught me. It is not until you grow older and have children of your own, that you realize how valuable those things you have been taught are.I want to thank Dad for always being there for me, always believing in me, and always loving me. I LOVE YOU DAD. MAY GOD CONTINUE TO BLESS YOU. I hope and pray that we have many more days together. Thank you for everything. Love, Kenny

They shall still bring forth fruit in old age...Psalm 92:14

Charles is a great guy and wonderful brother. Thanks for being there for me when I needed you. Money is no problem for Charles. He gets 3 checks a month for cleaning out the ditches on Bear Wallow Road. Happy birthday! Love (your brother), J.B. Crane

When I think of Charles, one thing stands out most in my mind. He asked me and my twin sister, Eula, to go to church at Livingston. On our way, Charles was driving awfully close to the edge of the road, which was close to the river. When we got to church, I needed dry clothes. If this leaves you to wonder about his driving, you draw your own conclusion, Ha Ha!Beulah Willis

My mind goes back to 1971. Charles was in a revival at Bobtown Holiness Church. At the alter call, he came and asked me did I want to pray, and I said, “I’m on my way.” Little did I know that in 2012, Charles would marry his sister, Beulah and me. God has been so good to spare him for 90 years.Rev. William Willis, Asst.Pastor Bear Wallow Holiness Church

I was in Wal-Mart parking lot going down the right way. I saw a red truck coming at me the wrong way. I said, “Who is that?” He rolled down his window and it was J.B.’s brother, Charles.Eula Combs

When I would stay all night with him and Granny, she would sit up with us and watch TV. Papa would go to bed and go to sleep. When he would go to turn over, he would get up on all fours and flip in the bed. I guess it was so he wouldn’t hurt Granny when he turned over in the bed. Joy Johnson Ritchey

Growing up you don’t realize what special moments you are having until you become an adult. Once adulthood takes over, those tiny moments from your childhood help shape the person you become.In my life, I have several people that provided those moments. My “Pap”, Charles Whittamore, provided many. I remember one summer when I was 6 or 7 years old and had a loose tooth. Pap had come home from work at dinnertime to check on Granny and us. He went inside, and I got into his work car, a white Ford Fairmont, as my memory goes. I was looking into the rearview mirror trying to pull my tooth. During this, I accidentally knocked the car out of gear, and it rolled down the drive, across the road, and into the ditch. I was scared to death. Pap came and got me out of the car. Just as Pap did this, a police officer was coming down the road. Pap stood firm and waited on the officer. He explained the situation, and in my young eyes, protected me.At that time, I did not understand him standing firm and facing life head on would have an impact in my life. Throughout my childhood and still today, I look to my Pap for help and wisdom in my life.Shane Johnson

Charles Whittamore is kind. He spends hours some days calling people to check on them and to cheer them up. He has always been more than kind to me. When I first started cooking, not everything was great. Kenny didn’t like all of it, but his Dad always ate everything and never complained. One of my favorite stories that Charles tells is when he fell into the shrubs at Berea Hospital moving some equipment. You should ask him about that if you want to laugh. Charles is like my Dad in that he had to go to work very young, and he didn’t get to attend school through high school. I have a great respect for Charles for his talents and abilities. He retired from Berea College after working many years in a super-visor position. He is a very smart man.Charles is a good leader with his church. He has a way of leading people without hurting their feelings. He is a man of great faith. If you have a need of prayer, I would recommend you go to his church.He is a good grandpa. He has always been there for Alyssa and Katie. If they were in trouble, he would try to stay out of the way. He never wanted to go against us as parents. He has done this for all his grandkids.Charles has made a difference to many people in this life, and I hope he will continue for many more years doing so.Tammy Whittamore

There are many stories I could tell about my grand-father. I could talk about my trips with him when I was a child, when he would take me to McDonald’s for a Happy Meal after a trip to the IGA. I could talk about how he let me jump on his bed and play with all of his fancy cologne, even though both my parents said I wasn’t allowed. I could talk about the random, unplanned trips to Wal-Mart we would make as a child, when he would buy toys for my sister and me for no other reason than the fact that he loved us and he could. I could even talk about the time we went on vacation in Florida and he insisted that a giant statue of a monkey was an old man, ulti-mately threatening that “if that’s not an old man, I’ll eat it!” All of these are fond memories I have of him. My fondest memories of my grandfather, though, are actually the most mundane.For my entire life, my grandfather has been around whenever I needed him or wanted him, be it as a playmate, a guardian, a mentor, or just a friend. Growing up, he listened to all of my stories and humored me in all of the games I played (or tried to play) with him, even though I’m sure they didn’t make much sense to him. He comforted me when I was sad and picked me up from school on the days when I was sick or when my parents couldn’t be there to get me. Whenever I got sick, he was always there to pray for me and to bring me anything I needed. These little things mean more to me that the big “memorable” stories ever could.Happy 90th birthday, Papa. Thank you so much for being there for me all my life, and may you receive as much love, happiness, and kindness today as you have given to me and so many other people in all your years. Alyssa Whittamore

Back in the first part of 2010, my beloved husband wanted to be baptized. He was battling with cancer. So, my Uncle Charles and Brother Darren Sloan came to our house and baptized my late husband out in our garage.June Bug (my late husband) had the biggest smile on his face. The smile that you could never forget. I could never thank my Uncle Charles and Bro. Darren Sloan enough for doing that for him. Just to see that smile on June Bug’s face was worth it all. Uncle Charles is so very special to me. I love him with all my heart, and I thank God we have been blessed to have him for 90 years. Love always, your niece,Terry Combs Pearson

We moved to Madison County in 1963 or 1964. We went to Bear Wallow Church, and Bro. Charles was there. He has been my pastor since then. So that’s been quite a few years. I knew his wife, Edna. She was a very nice lady. We love Bro. Charles and his family very much. We wish him a very Happy Birthday and many more.Loyd and Cora Baker

My most cherished memory of you will always be your unconditional love and your unfailing friend-ship. A true friend is one who steps in when the whole world steps out. Thank you for being such a friend to me.You are truly a great friend and fellow minister of the Gospel of our Lord Jesus Christ.I wish you a very Blessed and Happy 90th Birthday. God bless you, my dear friend.Your friend in Christ Jesus,Jimmy Chrisman

Charles has been my friend, my confidant, whom I love as a brother in Christ. I’m glad I have been a member of his church for 30 years. He has given us good preaching and teaching. May God bless you with many more birthdays!Vernon and Wanda Hisle

Charles is a very good preacher, a great man of God!Bobby Gadd

Charles is well loved. Phyllis Foster

Charles has encouraged me many times along the way, and we love him very much! He has always been my pastor, no matter where I went to church.Love, Randy and Jennifer Webb

Many highs, many lows. Bro. Charles has been on God’s road. May you travel many more.

My most humbling memory of Charles

Whittamore would be when all the guys

were in the garage. He came in and told the

crew, “Look how good my sons are working together.”

Love you Charles, J.R. Scenters

I first met Charles while he was working at Berea College. I got re-acquainted with him while his son, Kenny, was re-building a truck for me. It has been a blessing to me to have crossed paths with this family.Mike Robinson

My friend Charles Whittamore. In life, one makes many acquaintances but few friends. You epitomize what the Bible talks about in Proverbs 18:24. Ruth and I wish you a Happy Birthday. Certainly, you have been a good friend, and a brother in Christ. I treasure time spent in your presence. Have a blessed day.Your friends, Lawrence and Ruth

My first recollection of Charlie Whittamore was when I was a young man just back from the service, although I must have known him much earlier, since my Dad and Mr. Whittamore both worked for Buildings and Maintenance at Berea College.For about a month, Mr. Whittamore, my Dad, and I worked together in the evenings and weekends to renovate an old house that I had bought on Christ-mas Ridge. The three of us worked side-by-side, hammer-ing, sawing, and painting. We were enjoying our progress and fellowship. We didn’t talk very much, confident in the other’s ability and skill.Years went by when we had no direct contact, except seeing each other in passing and pausing for a brief visit. About seven years ago, I once again had the oppor-tunity to work with Mr. Whittamore. We renewed our friendship. Charlie is perhaps the most decent man I know. He is a stalwart Christian, living his faith with warmth and an acceptance for all, but most especially for his friends and family. I am proud to call him my friend. Happy Birthday Charlie!John Stevens

I have known Charles for many years but just re-cently developed a closer friendship with him. During this most recent period, I have come to see him in a different way. Charles is a deeply spiritual man, who has a fear-some loyalty to his congregation and his family. I have enjoyed his keen sense of humor, and he has a remarkable work ethic. He is a model and an inspiration for his friends. I am honored to call him friend. Happy 90th, Charles. You are a one of a kind! Richard Bellando

Dear Editor,

In 1977 a group of neo-Nazis wanted to hold a protest march in Skokie, Illinois. The city govern-ment denied the request and the Nazi organizers appealed to the ACLU. The ACLU sued the vil-lage of Skokie and after appealing all the way to the Supreme Court, they and their Nazi clients prevailed.

In a 1978 article titled Skokie as Symbol, author Jean Caffey Lyles says this about defending First Amendment princi-ples, “Skokie is a disturb-ing symbol to remind us that the shallowness of our commitment to those principles could ultimately jeopardize the rights of all of us. In the midst of the heated debate that is sweeping through our community regarding the rebel flag we need to ask ourselves if we are guilty of hold-ing a shallow or worse, selective, commitment to civil rights.”

Underlying this is-

sue seems to be a self-righteous smugness that says, “My values are su-perior to yours.” I have heard people who op-pose the sale of rebel flag memorabilia say it does not represent our com-munity’s values. That’s odd because I don’t re-member a referendum on collective community values being passed.

Our values are subjec-tive, and more diverse than we could ever deter-mine. I don’t know any two people, never mind an entire community, who share exactly the same values. For some-body to hold the moral high ground because their values are better than those opposing them is to say, “I know what is in your heart.” To hold that view is to be guilty of the worst kind of hubris. It is arrogant, judgmental, intolerant and dismissive, not to mention elitist.

The only thing we can say with certainty about the rebel flag is that it means different things

to different people. Un-less you have the super-natural ability to know what is in the hearts of others, you have no right to judge them. No doubt there are rebel flag own-ers who are racists and bigots. But in my experi-ence that is not represen-tative of the majority. It is hurtful to many of them to be judged so harshly by those who don’t really know them.

Let’s change the sce-nario a little bit. Suppose a vendor at the Spoon-bread Festival wearing Muslim clothing was selling hats, window clings and T-shirts that had star and crescent moon symbols on them. Many people would find it offensive and others would see it as threaten-ing. Many would say it does not represent our values. Studies tell us that only a small minor-ity of practicing Mus-lims hate America and western culture, but that has not prevented many Americans from having a prejudicial opinion of

all Muslims. To judge a whole group of people by the actions of a minor-ity would be arrogant, judgmental, intolerant and dismissive.

As long as nobody’s rights are being violated and the vendors are not doing anything illegal, let free enterprise reign. There is no compelling reason for any kind of action that would stifle commerce or censor free speech. If we do not dif-fuse this issue it will get out of hand and my prediction is that the Spoonbread Festival will morph into the Rebel Flag Festival. People will come from near and far, by the thousands, wear-ing rebel flag hats, shirts, buckles and tattoos. Flags will fly from cars, vans and pick-up trucks. Free speech will have it say. My hope is that our commitment to the First Amendment is not as shallow as political cor-rectness would dictate.

Rick FultonBerea

Let free enterprise reignMore letters from our readers

Dear Editor,

The Spoonbread Festival is a wonderful event where the business community has giv-en back to Berea residents and thousands of people from 25 states, during the last 20 years. Parking, kiddie land, music, street entertainment, hot air balloon glow, hot air balloon rides, tractor show, car show and parade are all free thanks to local businesses.

Designed around free fam-ily fun for all ages the festi-val is a safe environment for families to visit and enjoy lo-cal culture through arts and crafts, music, dance, food and activities. Among the first desires of developers was to bring our community togeth-er. There’s never been a racial harassment incident reported during the festival. Nor do we ever want one! Everyone is welcome. Festival Coordina-tors will not tolerate an envi-ronment where visitors don’t feel safe.

In our great country, we have rights. One is freedom of speech. If I don’t like what someone is saying, I have

the right to turn them off, walk away or not go where they’re displaying their right to speech. Berea is made up of very diverse groups. To be honest, some of them make me uncomfortable, but they have a right to be here as much as I do. These groups hang banners from their buildings that make me very uncom-fortable. But that’s their right and I keep my mouth shut. However, I don’t attend their activities nor purchase items from businesses that promote things I don’t agree with! This is my right.

Some bumper stickers I see on cars in our community down right scare me! But it’s their right to display them. My family and I are subjected to these signs of hatred day af-ter day. While totally against my beliefs and an embarrass-ment when one of my chil-dren many years ago asked me to explain the meaning of one of them, I have no control over what is stuck to the ve-hicle in front of me.

Roads are funded by my tax dollars as well as theirs.

SEE LETTER, PAGE A11

Chamber’s right to regulate Spoonbread Festival vendors

LEGAL NOTICE: Appala-chian Coffee and Tea Co. 124 Main Street Berea, Kentucky 40403 hereby declares intention to apply for a Limited Restaurant Li-cense no later than March 30, 2016. The business to be licensed will be located at 124 Main Street Berea, Kentucky 40403 doing busi-ness as Berea Coffee and Tea. The owner(s) are as follows: President, Charles Adam Walker of 102 High-land Dr. Berea, KY 40403. Any person, association, corporation, or body politic may protest the granting of the license by writing the Dept. of Alcoholic Bever-age Control, 1003 Twilight Trail, Frankfort, Ky. 40601-8400, within 30 days (KRS 243.430) of the date of this legal publication.40x1p

DRIVEWAY GRAVEL haul-ing & spreading. Residential 859-544-7730 35x17p

CALL BETTY LAMB LYNN 986-9160 for a brochure or Avon products. 8xtfnb

APARTMENT FOR RENT: 1 level, 2 BR. Close to Berea College. $450/mo. + dep. 859-200-8319 29xtfnb________________________APARTMENT FOR RENT 1 BR, excellent location. Utilities included, $450/mo. $450 dep. No pets allowed. Washer/dryer hook-up. 859-314-4706. 39x4b________________________TOWNHOUSE FOR RENT:Nice, 2 BR, 2.5 BA, laundry room, appl., privacy deck. $525/mo. + dep. & ref. 986-2525 or 979-5999 40x1b

HOUSE FOR RENT: Nice, 3 bed, 2 BA, brick house 110 Christmas Ridge $725.; Lg. 2 bed, 1.5 BA townhouse, 100-2 Morning View. $575.; All units have central heat & air. 986-2266. 12xtfnb________________________HOUSE FOR RENT: 3 BR, 2 BA. 1800 sq. ft. ranch. Appliances furnished. No pets. $950/mo. Ref req. 859-986-3389. 37xtfnb________________________HOUSE FOR RENT: Nice 3 BR, 2.5 BA, 3 car garage. $1000/mo. + $1000 dep. 859-358-0201 40xtfnb ________________________BRICK HOUSE FOR RENT: 3 BR, 2 BA, full basement, screened- in porch $1000/mo. + $1000 dep. 859-358-0201 40xtfnb

MOBILE FOR RENT: 2 BR in country, private lot. Appliances & w/d incl.Central heat & air, water incl. $500/mo. + $200 dep. Call 859-986-2264 40x2p

SPACE FOR RENT: 2200 sq. ft +/- with individual heat pump and electric meter, serving bar with hot and cold water sink and a bathroom. Room space for meetings and/or for storage. Asking $250 a mo. Call 859 200-5610. Ask for Jake. 34xtfnb ________________________COMMERCIAL SPACE: 3000 sq ft. warehouse w/ 2 overhead doors and office space. Close to I-75. Call 859-661-2090. 39xtfnb

LEVI JEANS $29.99, Car-hartt Jeans $26.99- Napier Brothers, 35 Public Square, Lancaster, KY. 6xtfnb________________________WANTED TO BUY: Your Antiques and collectibles. Antique glassware, furniture, quilts, all types of military items, clocks, watches (working or not), coins, and paper money. All types of gold, silver scrap, cast iron banks, toys, lighters, crock jugs, cast iron skillets, marbles, pocket knives, fishing items, Indian Arrowheads, and much, much more. Also buying partial estates. Over 25 years experience. Call: Clarence Reece at 606-531-0467 43xtfnb

HOSTESS NEEDED: Apply in person at Dinner Bell. 127 Plaza Dr. 40xtfnb ________________________DRIVERS: New Dedicated, Regional & OTR Openings! Excellent Pay, Benefits, Home-time! Paid Vaca, Holidays! 1yr CDL-A exp Call JST Today: 1-855-534-2792 40x2p

YARD SALE: 326 Peachbloom Hill Ln. Fri. & Sat. 9-? 1961 Barbie Doll case (Pony Tail) with accessories. 1960’s Mad Magazines, 1910 John Hunt Morgan postcard, antiques & stuff.

• LegaL Notice •

PLAZA DRIVESTORAGE

10x10 $35/mo • 10x20 $60/mo 10x40 $120/mo • 20x40 $180/mo

call/txt 200-7691, 582-4173


• apartmeNts •





[email protected]





661-3259, 661-2306986-7692, 986-4095


____________________

Blakewood Storage

Units for Rent661-3259, 661-2306986-7692, 986-4095

• services •

• LaNd for saLe •

• avoN for saLe •

• empLoymeNt •



Lancaster, KY





986-5644










Autumn Ridge




ROARING CREEKAPARTMENTS FOR RENT Luxury Townhouses in the

country, located 10 minutes south of Kroger and

1 mile north of Berea. Rent: $675 Dep.: $675 All utilities paid. Call: (859) 986-2040 (days)

(859) 986-8894 or (859) 661-0036 (nights)





Call (859) 985-7077


for sale. $50,000.859-986-4095

Subscribe to the Berea Citizen today! You can have the newspaper

delivered right to your mailbox.

Only $26 per year in Madison Co.$35 per year elsewhere

Send check to: PO Box 207 Berea, KY 40403 or

Call (859) 986-0959

• House for Lease •



House for Lease




Kids Who Read Newspapers

Research shows that students who read newspapers score better on standardized tests, continue reading into adulthood, have greater civic understanding and are more engaged in their communities.

DO BETTER

All real estate

advertising in The Berea

Citizen is placed in

conformity to equal housing

rules.

• Lot •

• mobiLe Home •

WILESTrailer Park

SPACE FOR RENT

859 661-3259 859 986-4095


859 661-0036

APTS &

• apartmeNts •











• commerciaL •

Call (859) 661-0304 or (859) 625-2528





Davis$20 - $60859-582-9710Hwy. 21 West

115 Linda Ln.

Storage Units

• yard saLe •

BRTODD INVESTMENTS


utilities included

2 BR Apartments

(859) 661-2950

• commerciaL •

• House for reNt •



$500 dep. 1 year lease. Call (859) 625-2760 after 3 p.m.

• misceLLaNeous •

Licensed and Insured Call Josh 859-868-8521

HEATING & COOLINGRepair and Replacement ADAMS & ASSOCIATES

859-623-1900632 Chestnut Street, Berea, KY 40403

www.realtyworldadams.com

REALTY WORLD®

TM





Berea & Richmond


ONE OF OUR AGENTS!

Kim GipsonRealtor

859-200-1864


859-623-1900


859-623-1900



859-779-9935

Paul HobbsRealtor

859-979-3040

Jason WilsonRealtor

859-358-3016



859-625-2066


859-358-6083


Paula MooreRealtor

859-358-4481

Donna MabesRealtor

859-868-8847

Kenny HowellRealtor

859-979-0462


859-302-2762

Nathan HackRealtor

859-351-9303

•660CollegeHillRd.Waco$57,000MLS#54152





•51FirstSt.$139,900MLS#53743


















•112GladesSt.Berea$92,500MLS#53054










NEW LISTING OPEN HOUSE SUN 2-4

NEW 199Morningview

RoadBerea

$119,900MLS#54222

524 Park Ridge Dr.

Richmond$327,900

MLS#54134Host:

Jason Wilson


623 CHESTNUT STREET • BEREANEW LISTING

This home has been completely remodeled and is absolutely gorgeous! Beautiful crown molding to accentuate the tall ceilings and classic wooden staircase. The living room fireplace gives a nice, cozy feel to this historic type home. Nice laminate wood flooring and ceramic tile, brand new thermal insulated windows throughout, new heat/air unit, large closets, full basement with outside entrance. Nice level lot, partially fenced with brand new roof. Large storage building with fall out storm shelter under ground. Located in beautiful downtown Berea, walking distance to Berea College. $110,000. MLS#53775


Agent Email: [email protected]

HOSTED BYStephanie Hembree

(859) 314-4706





ALSO AVAILABLE...





152 Old US 25 (Across from Silver Creek School) 1,500 sq. ft., 3 BR, 2 1/2 BA, 1 Car Garage, $144,900.








859-986-84011-800-998-2063 • fax 986-6173

FosterRealtors®


140 TREMONT DR. 4 BR, 3 BA full finished walkout basement 2 kitchens 1 acre $229,000 MLS#53250 Kristie Fain 582-6502 320 PINE STREET 3 BR, 1 BA, 2 1/2 BA $129,500 MLS#53192 Phil Malicote 582-8882 114/116 BAUGH ST. PENDING $79,900 MLS#52567 Phil Malicote 582-8882 119 LYNNE DR. New Construction 3 BR, 2 BA $196,900 MLS#53171 Phil Malicote 582-8882 138 LORRAINE COURT (Duplex) $92,500 MLS#53010 Phil Malicote 582-8882633 KING LUKE CT. (Kings Trace) 5 BR, 3.5 BA 1 acre $229,900 MLS#51812 Janet Bowman 302-3123645 WOODSIDE WALK (Condo) 2 bdrms, 2 bths $116,000 MLS#51922 Connie Lawson: 661-0285BOX 451 RT. PENDING MLS#51191 Janet Bowman: 302-3123 914 BIG HILL Rd Mt. Vernon 4 BR, 2 BA, fenced back yard 1 1/2 acre $75,000 MLS#50950 Janet Bowman 302-3123 79 CENTRAL AVE. 2 bdrm, 1 bth $59,000 MLS#50551 Phil Malicote 582-8882



DETAILS! 859/986-8401

Spring is here! Great time to list your property! Call us!

5115 WALNUT MEADOW RD. 1 1/2 Story, 5 BR, 3 1/2 BA, 1 acre lot. Finished 2nd Floor with plenty of room for 2 additional bedrooms if needed $269,000 MLS#54184 Phil Malicote: 582-8882 208 PEACHBLOOM HILL PENDING $138,500 MLS#54061 Phil Malicote: 582-8882 100 COLLINS DR. SOLD $192,000, MLS#54093 Keith Johns 625-4117616 C. VALLEY DRIVE 3 BR, 3 1/2 BA Log Home 40 acres $325,000 MLS#53952 Janet Bowman: 302-3123 182 E. HAITI RD. 3 BR, 2 BA, Basement style apartment. A must see. $99,900 MLS#53922 Lisa Foster: 582-1010 1050 FREEDOM SCHOOL RD. Mount Vernon 3 BR, 2 BA Doublewide on 1/2 acre lot. $59,000 MLS#53836 Don Foster: 582-1100 212 ADAMS STREET 2 BR, 1 BA Located in Artist Area Old Town Berea. Garage/Workshop $59,000 MLS#53767 Sune Frederiksen: 248-0690 1019 HONEYSUCKLE COURT 3 BR, 2 BA, 1 Acre $125,000 MLS#53735 Phil Malicote: 582-8882 726/728 O’POSSUM KINGDOM ROAD 2 BR (possible 3rd), 1 BA Recently remodeled 2.5 acres with barn, storage shed. Includes a 1,936 sq. ft. commercial bldg. currently being used as body shop with ef-ficiency apartment. $179,900 MLS#53707 Phil Malicote: 582-8882 120 N. BROADWAY STREET Historic City Jail & extra lot. Totally Updated. Great for Retail or Office. $155,000 MLS#53663 Phil Malicote: 582-8882 110 PARSONS LANE (Mt. Vernon) PENDING MLS#53505 Janet Bowman 302-3123 126 MEADOWLARK DR. 3 BR, 1 BA, $84,999 MLS#53408 Candi Vester 224-6550, Amanda Hill 661-0460

106 EXETER AVE. $27,500 Middlesboro Janet Bowman 302-3123294 DOGWOOD DR. - 0.49 Comm. Lot $100,000 MLS#52820 Candi & Amanda 224-6550 or 661-04601 PAINT LICK RD. - 6.13 Comm. Land. $1,500,000 MLS#53821 Candi & Amanda 224-6550 or 661-04601 DOGWOOD DR. - 8.51 Comm. Land $2,100,000 MLS#53822 Candi & Amanda 224-6550 or 661-0460FARM/ 2325 PEGGY FLATS RD. 182.56 acres prime farm land located 2.3 mi. from I-75. Completely fenced, 3 ponds, gently rolling. $912,500 MLS#53761 Phil Malicote: 582-8882 FARM/ 405 LOCUST BRANCH ROAD 543 acre farm, 200 year updated log home, plus modern 6 year old home. 3 barns, 2 machine sheds. Stocked pond. Guest cottage $1,200,000 MLS#53543 Phil Malicote 582-8882FARM/ 1775 GUYNN RD. 120.55 acres located within 3 mi. of I-75 & Berea.Barns, ponds, pasture, tillable land, woods & wildlife $350,000 MLS#53401 Phil Malicote 582-8882 BREEZY HOLLOW RD. 7.98 acres cleared land. Several bldg sites. $32,000 MLS#53517 Phil Malicote 582-8882 412 RICHMOND RD. - Comm. Lot. $49,900. MLS#48778. Phil Malicote 582-8882.

PUBLIC HEARING NOTICE

Please take notice that the Berea Planning Commission will conduct a public hearing on the 22nd day of March, at 6:30 PM, in the Council Chambers of the Berea Police and Municipal Building for the purpose of considering a proposal to amend the zoning classification of property located at 212-304 Chestnut Street & 103-108 Parkway Avenue from R-2/B-2 (Two-Family Residential/Major Business) to PSF (Public and Semi-Public Facilities).

The public is invited to attend and make comments.

Dale Van Winkle Cheryl ChasteenCodes Administrator City Clerk


105 LYNN DRIVE • BEREAGorgeous! 4 BR home with a view of the pinnacles in a very desirable neighborhood. Home has a spacious 1st floor master suite, & open floor plan with beautiful floors. Chef's kitchen w/double oven & stainless appliances, oversized pantry, & loads of storage in 5 deep corner cabinets. Office/den has custom shelves & extra deep cabinets for even more storage. The 2nd floor has 3 large BR & a 2nd family room that could double as an oversized 5th BR. Great colors throughout home. New Berea Victory garden raised bed! Great schools! Great Home!

OPEN HOUSE SUNDAY, March 13th, 2-4 p.m.

A NURSING AND REHABILITATION FACILITY

Apply at: 1043 Brooklyn Blvd. Berea, KY 40403(We are an equal opportunity employer).

Nurse AideState Registered

Position availableMedical Insurance • Paid VacationPaid Holidays • Free Life Insurance

Free (LTC) Disability • Dental Insurance401 K Retirement




(859) 986-9417home

(859) 302-8411mobile


(859) 986-9797


• 200 GINGER DRIVE - (42.67 ACRES) ...........................................................................SOLD $149,000• 1794 CAlICo RD. (50 ACRES +/-) ...........................................................................SOLD $110,000• RENFRo VAllEY - 11 ACRES ....................................................................................................$50,000• PEGGY FlATS RD. - CoMMERCIAl - EXIT 77 ............................... $500,000. owNER/bRokER

LAND

• 3006 NoblE CT. | wACo ............................................................................... $390,000• 104 wooDS TRAIl | RIChMoND (DUPlEX) ........................REDUCED $159,900• 137 CRoSSING VIEw DR. ............................................................... SOLD $119,900• 911 GREENwooD DR... ......................................................................SOLD $169,900• 124 CENTRAl AVE. (DUPlEX) ......................................................... SOLD $89,900• 128 CENTRAl AVE. (DUPlEX) ......................................................... SOLD $89,900• 262 ShoRT lINE Pk. (15.25 ACRES) .......................................REDUCED $160,000• 270 wIllIAMS ST. (MT. VERNoN CoMMERCIAl) .......... REDUCED $69,900• 211 GlADES ST. ....................................................................................SOLD $121,900• 446 ChRISTMAS RIDGE RD. .............................................................SOLD $125,000• 420 PlUMTREE DR. (NEw ShINGlES) ...................................................... $127,900• 2800 RIChMoND ST. (RENFRo VAllEY) 1A. ......................REDUCED $119,000• 2780 RIChMoND ST. (RENFRo VAllEY) ............................. REDUCED $70,000

OPEN HOUSESunday, March 13 • 1:00 pm – 3:00 pm

112 Allie Court • Berea

www.amylewis.demovellan.com (859) 582-6622

Amy Lewis, Realtor, GreenBerkshire Hathaway Home Servicesde Movellan Properties171 Prosperous PlaceLexington, Kentucky 40509

Immaculate 2-Story home with beautiful view in a quiet cul-de-sac. Stainless steel and black appliances with oak cabinets in the kitchen. The Master suite features include a trey ceiling, ceiling fan and walk-in closet. The outside storage unit has electricity.

Assistant Controller #2906Accounting

Mount Vernon, KY8:00 a.m. – 4:30 p.m. Monday – Friday

Occasional evenings and weekendsProvides oversight of the daily accounting functions; works closely with Corporate Controller in organizational budget preparation, monitoring, reporting and budget forecasting; conducts financial audits of various accounts; prepares financial and year-end reports; ensures compliance with GAAP, UPMIFA disclosure; federal and state local tax requirements; responsible for daily supervision and staff development of accounting team. Salary range: $46,904-$70,366. Requirements: Bachelor’s degree in related field. (CPA certification a plus). 4-5 years of successful experience in related field, or the equivalent combinationof education and experience.CAP offers competitive pay and benefits.

If interested and qualifiedPlease respond by March 18, 2016 to:

Christian Appalachian ProjectHuman Resources #2906

P. O. Box 459Hagerhill, KY 41222

[email protected] phone calls accepted

An Equal Employment Opportunity

The Christian AppalachianProject, Inc. seeks qualifiedand interested persons tofill the following position:

E911 Dispatcher - Madison County E-911is accepting applications for full time 911 Dispatchers.

Applicants must be a Citizen of the United States, high school diploma or GED, Have not been convicted of a felony or other crimes of moral turpitude. Must be willing to work any shift as needed, weekends, holidays, and overtime. Must be able to work irregular shifts. Must be able to prioritize, multi task and work well under extreme pressure. Ability to operate computer systems, maintain computerized and written files. Must have the ability to communicate effectively, orally and in writing. Ability to establish and maintain effective working relationships with co-workers, emergency responders, and the general public. 911 Dispatchers are responsible for receiving messages and/or calls for service via telephone, radio, teletype, fax machine or in person for police, fire, ambulance and other emergency services.

Deadline to apply is Monday, March 14, 2016apply on line http://madisoncountyky.us/jobs

ANTIQUES*VINTAGE TOOLS*HOUSEHOLD

Auction MAR 12 Sat. 10:00 A.M.

Location: Longview Farm Ag Bldg, 307 Mule Shed Lane Richmond, KY

Concessions—Peoples Bank Relay for Life Team Kenm Refrigerator, Magic Chef Gas Stove LP,

Western Saddles, Dining Table& chairs(6), Baker

Rack, Cherry Rope Bed, Cherry Spindle Top Twin

Bed, Shelves, Chairs, Ice Cream Chairs, Wash

Stand, Cabinet, Day Care Kids Tables, Lockers,

Chairs, Books, Mats; Lg Woven Basket, Comic

Books, Mitchell Tolle, Pat Banks art, Motorized 2

Wheel Scooter, Housewares, Rexall Store Jar,

Bybee, Advertising, Marbles, Radios, Tins, Car-

pentry Tools, 2 Old Lg Wood Carpenter Tool Box-

es; 1 w tray & saw, Machinist tool box, Clamps, (2)

Brick with raised Lincoln profile, Costume Jewelry,

Easter Collectibles, Box Lots&More

LONG AUCTION COMPANY WAYNE LONG 859-544 2254

NO BUYERS FEE

Berea Board of Education # 3 Pirate Parkway, Berea, KY 40403 (859) 986-8446 Fax (859) 986-1839

www.berea.kyschools.us

The Berea Board of Education will be receiving bids for banking services for the 2016-2018 school years per Board Policy 04.2.

All bids must be received by 2:00pm on April 13, 2016.

All local banking institutions are invited to attend a pre-bid meeting on Thursday, March 24, 2016 at 2:00pm at the Board of Education office to discuss the bid documents and process for banking services. A repre-sentative from your banking institution may attend this meeting. The necessary bid forms may be picked up at that time. If there is not a representative available to attend, the documents will be mailed upon request.

Please contact Debbie Holbrook, Treasurer, at 859-986-8446 with any questions.

PUBLIC HEARING NOTICE

Please take notice that the Berea Planning Commission will conduct a public hearing on the 22nd day of March, at 6:30 PM, in the Council Chambers of the Berea Police and Municipal Building for the purpose of considering a proposal for a wireless communications facility on the property located at 456 Paint Lick Road.




(859) 986-0373




859 200-2090

Most inquiries about Berea’s business community begin with the Berea Chamber of Commerce,

275 businesses strong and growing.

Our Chamber members enjoy: “Working Together for a Better Berea”

More Information

As a business owner, you do not have time to attend all of the public meetings and follow local, state and federal issues. Chamber mem-bership allows you to focus on your business while we work with local governments to represent the needs of our business community.

Our website provides information to the world 24/7. We conduct annual Legislative Trips to Frankfort to meet with our legislators and dem-onstrate how our state government works. We also promote regional workshops and seminars to allow you and your employees to learn about specific topics and issues.

More Business

Through the telephone, walk-in and internet inquiries, the Berea Cham-ber of Commerce takes great pride in referring our members. Much like the Better Business Bureau’s logo, prospective customers seek out the Chamber logos / window clings that are placed on the doors and windows of our Chamber members as a sign of a reputable business.

We offer referral services, an on-line business directory, member to member discounts and advertising opportunities for all budgets.

More Exposure

Exposure comes naturally when you are a member of the Berea Chamber of Commerce. Take full advantage of free publicity most businesses cannot afford.

We offer new member recognition, FREE ribbon cutting services, website links and numerous net-working events.

Join the Chamber

Today!

More Connections

Our Chamber members have a better connection to the commu-nity because they are connected to each other. In addition to our monthly newsletter and member-ship meetings, our Chamber members receive timely communi-cations through our email distribu-tion lists two and three times per week.

Your circle of influence is 275 businesses strong. Collectively we can accomplish things that we could not consider as a small busi-ness owner.

Join us for New Member Orienta-tion Sessions, Speed Networking, committee work and monthly membership meetings.

Apply on-line at www.BereaChamber.com or call 859-986-9760 to request an application. www.BereaChamber.com

ABSOLUTE

AUCTIONEER: DANNY FORD

www.fordbrothersinc.com Somerset, KY Mt. Vernon, KY London, KY 606-679-2212 606-256-4545 • 800-435-5454 606-878-7111

FB1589-4.89x4-MtVernon.indd 1 2/25/16 2:05 PM

ABSOLUTE




Saturday, March 19, 2016 at 10:30 am2008 Cherokee Trail, Richmond, KY

For an appointment to view this property or additional information,

please contact our auctioneer or log onto www.fordbrothersinc.com.

Charles Bowman & Paula Bowman’s 10 ACRES, BRICK HOUSE, BARN & PERSONAL PROPERTY

Rockcastle Regional Hospital and Respiratory Care Center in Mt. Vernon is currently seeking:

REGISTERED NURSES (RN)LICENSED PRACTICAL NURSES (LPN)

for Acute Care, Long-term Care, Special Care Units and Emergency Department (RN). Full-time, Part-time, and PRN positions available.

Apply on-line at rockcastleregional.org/careers

You became a nurse to care for others!

Big things are happening for our community at Rockcastle Regional. Be part of the team that is making a

difference in the lives of our patients.

Equal Opportunity Employer

PUBLIC NOTICEThe Berea Board of Adjustments will hold a Public Hearing on Wednesday, March 23, 2016, at 6:00 p.m. in the Council Chambers of the Berea Police and Municipal Building located at 304 Chestnut Street to consider the following request:

JUDY POULETTE - 306 PROSPECT STREET - REQUESTING A CONDITIONAL USE PERMIT FOR A STUDIO FOR ART INSTRUCTION

FOR CHILDREN IN AN R-2 ZONE



13.5 Acres on Narrow Gap Road located close to Berea, Richmond and Lancaster. Only minutes from I-75. Has nice woods and some pasture land. Hunters paradise, Maywood fishing lake and lodge nearby. $39,900.

Call Danny at 859-983-5050Danny Ayres Realty & Auction

859-792-4025

FOR SALE

112 Bryon Avenue • Berea

New Kitchen in 2014


859.625.4824

Suncrest Meadows


• (in basement) • Workshop/Tool Room • Gas Fireplace• Mad.Co./Berea Schools• Suncrest Meadows Subd.• Master Bath Skylite• Only $161,900

PRICEREDUCED!

March 10, 2016

THE PIRATE Berea Community School 2 Pirate Parkway Berea, KY

PASSION, PRIDE, AND PURPOSE

Follow Us on Twitter: @BCSPirate

Berea Community School prides itself on diversity, which is why at Berea Community students start at a young age understanding various cultures. Understanding cultural diversity can complete you as a person and will help you succeed as you grow and experi-ence the world, this is why it is very important at Berea Commu-nity. On Thursday, March 3, the students at Berea Community Elementary School displayed for their families and community what they’ve learned in social studies this year. During the event, over 650 people attended.The goal of culture night is to allow Berea students and their families to experience diversity in different cultures. Students spend weeks learning about an assigned culture, and then present on Cul-ture Night to their guests. Culture night is open to friends and family of all Berea studentsKindergarten students studied

BCES students celebrate cultural diversity on annual C u l t u r e N i g h t

Berea, First graders studied Mexico, Second graders studied Ireland, Third graders studied Japan, Fourth graders studied Kentucky, and Fifth graders stud-ied Native America. Fifth grader Reece Cvatican, a student who has participated several times in this event, stated,

“Culture night is always a lot of fun. I think it’s a great opportu-nity for students and families to become more culturally diverse.” Each grade chose a culture that compliments their curriculum, and they created art, food, and performances on that theme. The representation of countless coun-tries and our great state were set up throughout the elementary side in classrooms and the gym, all decorated with accuracy. Over the year’s Culture Night has slowly evolved. When it start-ed in 2006, teachers and students presented solely in classrooms, and each class studied different cultures. The places each grade studies now depends on their social studies curriculum. Fourth grade studies Kentucky and Fifth

grade studies Native America because of their social studies class.Students spend months learn-ing about their set country. They explore the different crafts, cloth-ing, religions, food, etc. During culture night, students get the chance to present three different things; crafts with information, food prepared and set up in the cafeteria, and a presentation put on by the whole grade. This year marked the fourth year second grade teacher, Brit-tany Kaylor, was the chairman of Culture Night. “Over the years it has become easier to be able to plan everything out.” When in the first few years, planning started in November. Ms. Kaylor added, “This year we started in January. I believe that this year was a huge success not only for all the teachers, but also for the students and all of their hard work.” This year was the 10th culture night, and, according to students, teachers, and families, it was a huge success.

On Tuesday, March 1, Berea Community High School fresh-men visited Bluegrass Commu-nity Technical College (BCTC) to tour the campus and learn about some new possible options for their future. Mrs. Charlotte Hay-craft, the Gear-UP coordinator for BCHS, was in charge of the event to make sure everything went off without a hitch. The Freshman class arrived at BCTC around 10:00 a.m. and entered an auditorium where influential figures talked to the students about a number of different topics. The speakers discussed past students who had gone to BCTC and graduated from the community college and what they did with their lives and career afterwards. The speakers

also mentioned what student’s expected salary might be when they graduated from BCTC, depending on what field they intended to go into. The speaker discussed the efficiency of going to BCTC for a student’s first two years of college and then transfer to another college for their last two. While some students turned their nose up at the idea of attend-ing a community college, others considered it a very viable option because community colleges are often vastly cheaper than state or private universities. “It might just be me because I know I don’t want to attend com-munity college, but I feel like it could have been more education-al,” said freshman Maria Murphy. Overall the trip was a success and the Freshman got to learn vital information about higher education.

Freshman students visit and tour BCTC

Joseph CaudillPirate Staff Reporter

emma WhitePirate Lead Photographer

Kyra morganPirate Staff Reporter

photos by Joseph Caudill

Three students at Berea High school have applied for an op-portunity that would allow them to take college classes while in highschool. The Carol Martin Gatton Academy of Maths and Sciences at Western Kentucky University, which is called Gatton by most, is the foremost public school in Kentucky. Gatton is run by the Center for Gifted Studies at WKU, under the director Dr. Julia Roberts. Gatton students stay in Florence Snyder Hall on WKU’s Campus. At Gatton, students take all college classes. They are in class alongside the college students and take sixty credit hours by the time they graduate high school. The students are dual enrolled at both Gatton and their high school. Gatton has a focus on STEM (Science Technology Engineering and Mathematics) subjects and really pushes their students to get involved in the research and projects that go on in these fields on campus. This year, Berea Community High School had three sopho-mores apply: Virginia Deaver, Kyla Wilkie, and Ian Wilkie. There are three stages of applying to Gatton: the application, which is reviewed, the interviews, then and finding out whether or not they got accepted. Getting to the interview stage means that ap-plicants are automatically on the waiting list for Gatton. All three of these students made it to the interviews portion. Which was last saturday, and all the Gatton applicants were there. “It was a really great experience getting to meet the all of the other appli-cants, because I hadn’t really been around that many from other schools. It was really nice to get to be around a bunch of people who were there for the same reasons I was,” said Virginia Deaver. Kyla Wilkie was accepted into Gatton Academy. “I think it's a pretty great opportunity,” said Kyla Wilkie.

Berea student accepted to

Gatton Academy

Berea Community Drama Dept. Presents:

“Our Miss Brooks”March 17, 18, and 19 at 7 p.m.

$5 admission at Kennedy Theatre

“People come first and are treated with dignity and respect; lifelong learning, scholarship and service; diversity and inclusion of people and thought; excellence, honesty, integrity, and trust.” These are just a few of Morehead State University’s (MSU) core values that students strive to exemplify. On Tuesday, March 1st, the Berea Community High School sophomore class went on a col-lege visit to MSU. This field trip helped expose the students to college life at MSU as well as the application process. While at Morehead, the students learned about the university’s dif-ferent clubs and activities, scholar-ships, academic programs, and housing, financial aid, and even toured the campus. Sophomore Mikaela Morgan, who visited the campus, said, “We also learned that Morehead was founded as a school to teach teachers, and I have always personally been interested in pursuing a career in

education, so it was neat to hear about their program and the his-tory behind the school.”The students weren’t the only ones that learned something new about the university. Chaperone and teacher, Travis Blankenship said, “The fact that they [MSU] are ranked the safest campus in Kentucky was kinda surprising for the size of the school. I was under the assumption... that smaller [liberal arts] schools generally are safer, but learning about that was really fascinating.” Sophomore Elliot Sandberg added, “The best part of the trip was probably seeing how the school [MSU] interacted with the students... [current students] came together to pay for the [new] recreation center.” Both Morgan and Sandberg thorough-ly enjoyed the visit and thought that the trip to MSU was very interesting. After a successful trip to MSU, Blankenship said, “... it’s really impressive. Hopefully many of our students will feel like they will want to go there.”

abner KrousePirate Staff Reporter

Sophomores take field trip to Morehead State

On Tuesday, March 8 2016 the journalism and media students of Berea Community High School traveled to Cam-bellsville, Kentucky to attend the Kentucky Highschool Journalism Workshop. Highschools from various counties were invited to the event that included an in-troduction by guest speaker Connie Leonard. Leonard, winner of eleven Emmy awards, described to the engaged students the impor-tance of siezing opportunities in Journalism particularly in order to achieve your goals. After the inspiring introduc-tion, students attended vari-ous classes on broadcasting, proofreading, ethics, social media, etc. These 9 a.m. ses-sions provided opportunities for mass communication stu-dents to fine tune their respec-tive crafts.

Junior journalism student Tyler Isaac said, “In Sports Broadcasting they talked about how they put [informa-tion] on their website...they actually had a video make it on ESPN that was filmed at Cambellsville.” Students attended second sessions at 11. a.m., which ranged from public relations to acting for the screen. After their second session, the students ate lunch togeth-er in the cafeteria. To wrap up the trip to Cam-bellsville, the students took a guided tour of campus. The tour allowed students to learn more about the opportunities that a small campus offers to mass communication students.

“ [The trip offered] opportu-nities for a career [or[ major they hadnt thought about pursuing,” said media teacher MaryAnne Sowers. Overall, the trip to the Ken-tucky Highschool Journalism Workshop was a success.

Students attend Kentucky Highschool Journalism Workshop

Katie oKumuPirate Senior Editor

Elementary school students Ainsley Woodward and Luke Miller dance together during Culture Night celebration.

First grader Anothny Rodriguez presents project on the country of Mexico during Cultture Night.

Journalism and Media students who attended Kentucky Highschool Journalism Work-shop pose for photo in front of the Cambellsville campus.

THE PIRATE STAFF

SENIOR EDITOR: Katie Okumu

SPORTS EDITOR: Kenzi Daugherty

JR. SPORTS EDITOR: Clay Beavin

MANAGING EDITORS: Virginia Deaver, Claire Hogg, and Greg Schloemer

REPORTERS: Obi Okumu, JD Lovell, Huaiyu Chen, Tyler Isaac, Billy Richmond, Kyra Morgan,

Brandon Doering, Joseph Caudill, and Abner Krouse

LEAD PHOTOGRAPHER: Emma White

ADVISER: Mrs. Angela Baker

BEREA COmmUNIty SChOOl NEwS

The Pirate is published by the BCHS Journalism Class

Spring sports for Berea Commu-nity is imminent.Baseball, softball, tennis, and track have already begun practicing for this year's upcoming season.Although baseball’s last year record was (7-18), The Pirates are working on improvement for a better upcoming season. “I’m very excited, I think that we’ll have a good year. I think that we’ll have an even record this year” said Tyler Pumphrey. To get ready for the upcoming season, the baseball team has been working on an improved batting average and fielding. They have showed improvement in practice by hitting from the pitching machine and constantly working on fielding grounders.The Pirates have small but strong

lineup heading into this season with some experienced seniors.According to the head coach Ste-ven Bailey, “This year we have three seniors on the team semi-colon Trevor Woods, Sean Long, and Jayson Smith. Trevor and Sean have played on the team since middle school so the advan-tage that will bring to the table is valuable experience in leadership. Although being his first year on the team I also look for Jayson to provide a voice of leadership.” The Pirates Baseball start off the season away at Jackson County on March 10. The Pirate Softball team is look-ing come back after the loss of two valuable seniors with a good season. The Pirates ended their season last year with a record of (8-11) and are working hard this season to better that not only

by practicing but by becoming a closer team.

“My goal as a coach this year is to make everyone a better player, and come together as a team,” said assistant coach Jeff Sandefur. The Pirates first game is on March 15 at home against Gar-rard County. This year’s track and field team are going to be entering the up-coming season with a new coach, Erica Woods. The track and field team have experience and strong senior line up, alongside a great coach to start the season. “The coaches this year are really knowledgeable and is the best coach that we’ve had,” said Josh Lamb. The first track and field meet is Saturday, March 12.The Boys and Girls tennis team

is also entering the upcoming season with a new coach, Michael Slaughter. “Goals for myself and the team are making it pretty far in region-als and also to make it to team regionals” said senior Dalton Gadd. “I expect this year’s team to grow a lot as players, partly because we have a lot of young players and partly because we have a of of determined upper-classmen who i believe will really be working to step up their game”

said head coach Michael Slaugh-ter. “I hope we go farther in region-als then we did last year, and we finally have enough people to go to team regionals, so I hope we do that” said Candace Elam. The tennis team’s first match is Friday, March 11.As the year is coming to and end, spring sports are just beginning. The change is a reminder to stu-dents that there are a few more practices, a few more games, and few more senior nights left to go.

Spring Sports Previewbilly riChmondPirate Staff Reporter

tyler isaaCPirate Staff Reporter

While the juniors from Berea Community High School were working hard on their state ACT exam, many seniors experienced the workplace firsthand. Mem-bers of the senior class participat-ed in job shadowing on Tuesday, March 1st. Job shadowing is a way for seniors to explore careers they have expressed interest in. It also gives seniors an opportunity to discover careers they might have not considered before. Berea Community High School guidance counselor Eef Fontanez has been leading the program since its inception. He said about the program, “We've been doing job shadowing for the last six years. It's part of our college and career readiness path. We encour-age it so that students can validate the career path they want to enter or make the decision to not enter that career. It gives students a hands on look at the career they have expressed interest in.” Della Walter spent a day shad-owing with Rachel Small Stokes, the associate pastor at Union Church. Della started her day by studying The Bible with retired ministers. After the study ses-sion, Della meet people from the community to discuss the welcoming of newcomers, and made visits to church members’ house. “I learned not only about the ministry, but also what be-hind the scenes; people I worked with were very inclusive; this experience allows me to see the day to day part of the job,” said Della. Della chose Union Church because she has an interest in the ministry field, but she has not decided yet if she would become a minister in future. “I job shadowed Ms. Colegrove in the elementary. She is one of the special needs teachers on that side,” added Nick Carpenter. He also expressed his interest in the field, saying that it was a career he was definitely considering.The seniors gained great first hand knowledge on possible career paths through Job Shad-owing Day. This exposure will provide a lot of help when it is time for them to pick careers.

For current and former students of Mrs. Angela Baker, a junior-level English teacher at Berea Community High School, “PEEL paragraphs” are no unfamiliar concept. For the rest of the school, however, this new-and-improved way of writing is only now be-coming a rhetorical tool.

“PEEL,” an acronym for: point of paragraph, evidence, explain, and link to thesis, “is a framework for analytical writing,” said Mrs. Baker. “It helps students answer prompts with the questions ‘why?’ and ‘how?’” The concept of PEEL is fairly simple: when writing a para-graph, students should, first, establish a clear “point of para-graph.” In other words, the writer should make it clear to the reader what they intend to convey in

the sentences that will follow. After clearly stating their point, the writer should then present one piece of evidence (typically in the form of a quote from an article, novel, or other text), then should proceed to explain that evidence and its relevance to the point of paragraph. For a fully-developed paragraph at a junior or senior-level course, the two Es (evidence and explain) should be repeated three times, creating a paragraph with three solid pieces of evidence. Finally, to conclude the paragraph, the writer should link back to, in the case of essay writing, the thesis (main idea) of the work. After noticing PEEL’s great suc-cess in Mrs. Baker’s classrooms, Berea Community Middle and High School Principal, Mrs. Donna Lovell, asked Baker to help teachers and students imple-ment it throughout the entire school and across a variety of

subjects. Since the beginning of the second semester, she has held two workshops to train faculty members on the use of the tool. She has been available to teachers beyond those sessions PEEL, though predominantly being used for English classes, can be utilized in any subject such as science. Mr. Joshua Woodward, a science teacher at Berea Com-munity High School had this to say “It really helps to show me if a student understands the topic they are writing about or not. A poor writer can not clearly show if they understand the topic or not, however with the PEEL method students are taught to write more clearly, therefore I can clearly un-derstand what a student compre-hends and what they may need a little more information about.” “It’s helped,” said junior Alex Horn, who has been using PEEL paragraphs in nearly all of her classes, “because it helps organize

my writing and allows for better explanations.” The technique reaches even fur-ther than increasing student com-prehension. Mrs. Angela West, a BCMS social studies teacher, has also noticed the benefits of utilizing the PEEL writing pro-cess. “I have students come up to me in my social studies class and say that they used the PEEL technique to help them write a speech, or just when analyzing a historical document,” Mrs. West said. “It really gives the students a smooth transition to high school level historical analysis. It is a great tool for critical thinking.” In commenting on her experi-ences with PEEL inside her class-room, Mrs. West has touched on the most important aspect of the writing technique: it is an incred-ibly valuable tool in critical think-ing. That makes it, for students, useful not only in the classroom, but in all areas of life.

This spring, Berea Community Elementary School’s library has started a new reading initiative for its Pirate readers. Larinda Agee, the Elementary school’s librarian, has brought to life a

“Golden Ticket” reading contest to excite students. Berea Community Elementary Golden This ticket initiative is a contest designed to inspire young Pirate readers to read through as many elementary library books as possible. Golden paper tickets are randomly hidden within books throughout the library, waiting to be found by a student reading through their chosen story. If a Berea reader finds

a ticket within their book, he/she is given the opportunity to redeem the ticket for a prize from Mrs. Agee. Alexandria Mullins, a fifth grader at Berea Elementary, was lucky enough to discover two golden tickets in the books she had checked out. “It’s really amazing,” said Alexandria about finding her tickets, “it’s an unbe-lievable thing, like, you flip the page, you find it, and you’re like ‘Wow! I wonder what I’m going to get!’...It’s a mix of wonder and amazement...an unbelievable feeling that you might not always experience…”Alexandria found her first golden ticket in the book Smile, a graphic novel, and her second in her favorite book series, the Hunger Games. “...I’ve

already read [the Hunger Games] once, but I really wanted to read it again,” said Alexandria. The Golden Ticket Contest is one of the first Berea Community Elementary School reading incen-tives to be highly run by Berea Pirate Library Leaders, a group of elementary students who are in charge of organizing sections of the library. “I’ve seen them [Li-brary Leaders] be very strategic,” said Larinda Agee. “...like the little girls who have the picture books about snow and hundreds day and stuff, they hid theirs in there because they were like ‘Oh! I bet these will be checked out!’...because of the season...and then some students have put theirs in newer releases or books that are

really popular right now. It’s cool to see them thinking about the strategy.” With 8 to 10 Pirate readers al-ready having found golden tick-ets within their books, excitement has begun to spread among the elementary students. “Now that there have been a few [winners] in every grade level,” stated Agee.

“It’s kind of spread to where I can see the kids up here [at the library desk] when they’re checking out saying, ‘Ooh, I hope maybe I have a golden ticket in here! Maybe when I get home tonight I’ll have one!’, so it’s exciting to do that too.” The Berea Community Elemen-tary Golden Ticket Contest is set to last until the next big Pirate

Melting snow and flowers sprouting out from the ground are not the only things changing as winter rolls away and spring approaches. With each new sea-son of weather, there is always a new season of fashion as people rush to transform the staple pieces in their closets to match both the weather and current styles. Several trends are go-ing to make appearances in the coming weeks, both on runways and in Berea Community High School students’ wardrobes. For girls, this year’s spring looks will contain a lot of girly, feminine pieces with 70s-in-spired undertones. Fringes will make a strong return on the bottoms of tops, kimonos, and

handbags. Long, tea-length skirts will replace the short, skater skirts that have been on racks since 2013. Shoulderless cropped shirts with Woodstock vibes will also appear. As the cool shades of black, military green, and raspberry begin to fade alongside the cold wind, bright, pigmented shades will splash into stores. Sunshiney buttercup, bold peach, soft periwinkle, iced coffee, and lilac grey are just a few of the hues that are expected to color outfits of students during the warmer months. Senior Kerri Adkins expressed that one of her ideal spring out-fits includes pairing muted shirts with light-weight cardigans, jeans, and strappy sandals. Alongside the new trends for girls are the new spring styles that are going to pop up in male

wardrobes. Spring fashion for men this season was all about faux fur coats, turtlenecks, and elevated suiting. Pants were also bigger and baggier this season in lines from Versace, Tom Ford and Giorgio Armani. High waisted jeans and bellbottoms replaced the once popular skinny jeans. Fashion for men is evolving, and it seems bigger is in and smaller is out this season. One person not bucking this trend is Brandon Fletcher. “I think the trend looks like you're stuck in the 90’s,” the fashionable senior commented. As the cold and dreary Janu-ary months change into the cool summer weather of summer and spring, fashion will evolve from the once short skater shirts that once populated the hallways of Berea Community.

PEEL paragraphs implemented to increase critical thinking skillsJd lovellPirate Staff Reporter

greg sChloemerPirate Managing Edtior

Golden ticket initiative a success with elementary students

virginia deaverPirate Managing Edtior

Spring Blood Drive March 17th from 10 am to 3pm.

Sign up at the HS Guidance Door.huiayu Chen Clay beavinPirate Staff rePorterS

Spring Fashion Update

Claire hoggPirate Managing Edtior

obi oKumuPirate Staff Reporter

Job Shadowing

Berea Community Middle and Highschool Archery team members pose for a photo.

SPRING BREAK IS COMINGMarch 21-25

called to the 100 block of Churchill Court because of a theft. The caller said sev-eral items were stolen from a parked vehicle. The esti-mated loss was $100.

Falsely Reporting an Incident• On March 6, officers were called to Blackberry Lane because of suspicious activity. The caller said he was being held inside of an apartment against his will by a man with a weapon. Officers eventually were able to gain access to the

apartment and made con-tact with the caller. They discovered that he had not been held against his will and there was no one else with him. Officers arrest-ed Paul Lamb, 30, of Rich-mond. He was charged with second degree falsely reporting an incident and disorderly conduct.

Public Intoxication• On March 6, officers were called to Walmart because of a woman in the store who was under the influence. Store employ-ees said she was placing merchandise in the floor and had been laying down in the aisle. Officers ar-rested Tarol Johnson, 28,

of Berea and charged her with public intoxication.


POLICECONTINUED FROM PAGE A1

Kindergarten RegistrationFriday, March 11, 2016Friday, March 25, 2016Friday, April 22, 2016

8:00am – Noon & 1:00pm – 5:00pm

Central Office Conference RoomItems to bring that day

Birth Certificate, Immunization Certificate, Health Exam, Eye Exam, Dental Exam, Address Verification

(For Example: Gas, Electric, Water, Phone Bill orRent/Lease Agreement)

Any questions please call:859-986-8446

Berea Independent Schools3 Pirate Parkway, Berea KY 40403


ANGLIN’SBODY SHOP




986-2492

Supported by

“I’m Alive... because of

organ donation!”

Leeya, Liver Recipient

www.trustforlife.org866-945-5433

Food Service Inspections for Week Ending February 26, 2016

Regular Inspections With No Follow-Up Due ScoreTaco Bell, 514 Eastern By-Pass, Richmond 96%Long John Silvers #3033, 530 Eastern By-Pass, Richmond 92%Daniel Boone Elem. Cafeteria, 710 N. Second St., Richmond 99%Berea Community, 1 Pirate Pkwy., Berea 100%Mi Pueblo of Richmond, 465 Eastern By-Pass, Richmond 95%Model Laboratory, 521 Lancaster Ave., Richmond 98%Silver Creek Market, 865 HWY. 1016, Berea 98%Tienda Hidalgo, 517 Leighway Dr., Richmond 96%Caffeinated Colonel, 401 University Dr., Richmond 96%Eastern Univ. Frisch’s, 136 N. Keeneland Dr., Richmond 93%Mad Scoops, 330 Eastern By-Pass, Ste. 3, Richmond 100%

Follow-Up Inspections With No Follow-Up Due ScoreMinit Mart #661, 100 Prince Royal Dr., Berea 98%Outback Steakhouse, 400 Highland Park Dr., Richmond 99%Madison Manor, 131 Meadowlark Dr., Richmond 100%

Follow-Up Inspections With Follow-Up Due Score Madison Manor, 131 Meadowlark Dr., Richmond 93% *Potentially hazardous foods found having expired dates.

F O O D S E R V I C E I N S P E C T I O N S

Should I ask City Council to ban all bum-per stickers? No, that is ridiculous! It’s their right to put whatever they want on their ve-hicles. This is America!It is, however, my right and responsibility to ensure my community is safe by electing of-ficials that won’t tol-erate any small group ruling our community; officials who will lis-ten to all and not allow anyone’s constitutional rights to be taken away. Tourism has funded another event in Old Town. I attended once and frankly, felt very uncomfortable. Guess what? I’ve never been back. That’s my right.

Applying rules to the Spoonbread Festival that aren’t being im-posed on First Friday and others using public property and receiving tourism funds is dis-crimination.

This festival is for the community, but belongs to the Berea Chamber of Commerce and its 275+ tax paying businesses and indi-vidual members.

If merchandise be-ing sold makes you uncomfortable, please stay home! That’s your right, it’s the Cham-ber’s right to regulate the vendors as they see fit, it’s their festival!

Sandy RowletteA Spoonbread Founder

LETTERCONTINUED FROM PAGE

A1

Dear Editor,

Denmark has been men-tioned numerous times in the American political de-bate.

Denmark is a constitu-tional democracy Denmark, with a one-chamber parlia-ment with 179 members. Of those members, 135 are elected in their respective constituencies and another 40 are elected across Den-mark and divided by the political parties that pro-portionally get the most votes. Greenland and The Faroe Islands are represent-ed with two members each.

It is difficult for one party to win the majority; it hasn’t happened for more than 125 years because many parties are represented in the par-liament. This time around nine parties. This means the Danish democracy is de-pendent on compromises.

It is a common notion in America that Denmark is a socialistic country, but in the past 50 years the gov-ernment has been led by a right winged/center coali-tion for 30 years, and the other 20 years by a social democrat prime minister supported by center and small socialistic parties. It is important to realize that the Social Democracy is a very democratic party that ac-cepts the capitalistic market

economy, which includes the term “demand and sup-ply”. So calling Denmark a socialistic country, or a communist country is not correct.

It is correct the Danish welfare state is built on the idea of a big common mon-ey box that pays for most education, roads, airports, medical treatment, military, long term unemployment, et al.

A proportional tax system is used in Denmark. The first $6,500 is tax free for all. Average municipality/county tax is 25% of every-thing above $6,500. The fed-eral bottom tax is 8% of ev-erything above $6,500 and below $60,000. The top tax is 15% of everything above $60,000. A labor market contribution is 8% of every-thing above $6,500, and a health contribution is 4% of everything above $6,500. A voluntary church contribu-tion is .75%.

There is also a “VAT = val-ue added tax” on all goods and services of 25%. There will be a tax deduction of 20% of your travel expenses if you drive to work.

Example 1: If you make $50,000 annually, your taxes are approx. $18,700, with no deductions.

Example 2: If you make $600,000 annually, your annual taxes -- including

church tax -- are approx. $291,180 if you have no de-ductions.

Example 3: If you make $12,000 annually your taxes are approximately $2,255.

You pay additional taxes on cars and gasoline. To make a comparison, in Den-mark you will pay approx. $55,000 for a new Toyota Camry. However, the pub-lic transportation system is extensive.

It is always about choices, but I think Danes are good at looking at what is left af-ter the taxes and what ben-efits are included, not on how much they pay. The benefits are colossal. E.g. my own father spent three months in a hospital, part of the time in ICU, after a heart attack. We never saw an invoice, because it was paid for via taxes. Today students are being paid ap-prox. $800 to go to college and tuition is free. The pub-lic may choose to send pa-tients to private hospitals.

A long way down the road both the Conservatives, Moderates and Socialists believe it is better to have a healthy and well educated workforce and that is what the higher taxes ensure.

It is not unusual that voter turnout is close to 85-90%.

Sune FrederiksenBerea

More letters from our readersAbout Denmark, from a native

Emma White from Berea has been accept-ed to the University of the Cumberlands for the upcoming academ-ic year. Emma is a cur-rent student at Berea High School.

University of the Cumberlands offers promising students of all backgrounds a first class education grounded in the liberal arts within a Christian context.

UC Accepts Berea Student

to plant, and what tools might be helpful. The Li-brary will host the May 17 class on raised bed maintenance and include information on weeding, pest control, and disease control. Topics for later classes include harvest-ing and safely storing crops, how to extend the growing season, cooking and preserving the har-vest, and seed saving for next year’s garden.

The inspiration for the series is the Berea Vic-tory Garden Blitz, to help those who receive a new garden bed know what to do with it. Olson shares, “I started gardening when I was in my 50’s and was amazed with how easy it

is to grow food in a raised bed.” Those who want a raised bed through the Blitz this April can call 859-985-1689.

Hilgenberg will share her expertise at other events during her visit. She will speak at the Sustainable Berea An-nual Meeting on March 14th at 6:30 about Edible Landscaping, or the mar-riage of flowers and food. The afternoon of the 15th, from 2:30 pm - 4:00 pm, she will work with the Berea Arts Council, Sus-tainable Berea, and Fiber Frenzy to plan the re-make of an unkempt lot by Fiber Frenzy on North Broadway into a garden. The public is invited to interact with Lisa and bring any questions they might have about grow-ing food and flowers, trees and shrubs.

GARDENCONTINUED FROM PAGE A1

the police if they notice any activity.

In other business:• Mike Eckler was

re-appointed to the Eth-ics Board, and Barger was re-appointed to the Valley View Ferry Board.

• Steve Tussey was appointed as a county representative for the Madison County Region-

al Airport.• Andrew Blevins

was hired as a trainer for the CSEPP program, and Tom Webb was hired as a planner. They both were hired at a higher salary, $38,500, because of their experience.

• Sarah Maupin from E911 was promoted to shift supervisor. The 911 department is cur-rently very short-staffed, with seven openings af-ter two employees leave this month.

COUNTYCONTINUED FROM PAGE

A1

Berea Citizen,Always Local,Always There

from Berea Tourism. For this 20th year anniversary, however, the Chamber re-ceived a four-page docu-ment with added require-ments and regulations.

Mayor Steve Connelly, who writes up all the con-tracts for the City of Berea, said he meant the draft agreement as the begin-ning of the conversation that needed to take place between the City and Chamber.

“It has been mentioned that they [chamber staff] want to grow even more in the future,” Connelly said, “and city staff has already been talking about chal-lenges we’re having with how large the festival has grown. There were electri-cal concerns by the staff last year, so I wanted to be-gin the planning early, and start the conversation with the chamber.”

The issue of prohibiting the sale of Confederate flag memorabilia, Connelly said, was just a small part of the agreement. He add-

ed that addendum both because of the controversy of the Confederate flag, and the recent decision by the Kentucky Fair Board to prohibit Confederate flag memorabilia in their future contracts.

Connelly pointed out that even though the grant the Chamber receives of $5,000 is fairly small, the chamber relies heavily on city support for the festi-val. Employees from the police department, codes office and streets depart-ment work a great deal of overtime during the festival regulating traffic, cleaning bathrooms, moni-toring vendors, and pick-ing up trashing.

The city has estimated, Connelly reported, that their in-kind contributions with the Spoonbread Fes-tival along with the grant costs the city anywhere from $20,000 to $30,000.

Napier said that when she and a Chamber staff member met with the city administrator, they were told that all the items in the draft agreement were negotiable except for the Confederate flag item.

“I asked them if the city would consider an ordi-

nance against the selling of the Confederate flag, but was told that would be il-legal for them because of free speech,” Napier said, “so they were essentially asking us to do something that they can’t.”

And that, Napier said, was the essential reason the Chamber feels they can’t comply with the re-quirement to ban the flag.

“The problem is that city leadership is asking the Chamber to do things they wouldn’t do them-selves. The problem is not the Confederate flag itself, but government mandat-ing what can and can’t be sold at the Spoonbread,” Napier said.

As far as the other con-cerns listed in the agree-ment, Napier said, it wasn’t the responsibility of the chamber to enforce things such as how elec-tricity is used or requiring vendors to get a business license.

Chamber members have had meetings with the mayor and city adminis-trator on the agreement, but no resolution has been reached. Chamber mem-bers related that they were considering moving the

festival from its usual spot on Jefferson and Broad-way; something that sur-prised the mayor.

“I heard from the Cham-ber that this would be a deal breaker,” Connelly said. “There’s obviously more conversation that needs to take place. The fact is, other cities and or-ganizations have reviewed banning the Confederate flag because it’s such a lightning rod, so why in-ject this sensitive issue into Berea’s fair?”

Napier pointed out that the year before, there was a vehicle in the car show painted like the General Lee from Dukes of Hazard, with a Confederate flag painted on top. It won one of the trophies.

“Would we say that car couldn’t enter the contest with this regulation?” Na-pier asked. “We’re willing to work with the city, but this is a really deep-rooted issue.”

Currently, there are no meetings planned between the Chamber and City. The Chamber of Commerce members are discussing whether they could turn down the grant from Berea Tourism, which may make

the agreement in question null and void.

“We also have to look to the future, even beyond this problem,” Napier said. “What’s next? Do we ban

political parties? Religious groups? That government control is a problem.”

Later, Napier said, “I just ask people in Berea to pray about this.”


HORNSCONTINUED FROM PAGE A1


David Fligor

DISCOUNTPHARMACY

WelcomeDAVID








MEET YOUR MORTGAGE BANKER AT YOUR FAVORITE COFFEE SHOP.

BANKING • WEALTH MANAGEMENT • INSURANCE • INVESTMENTS

NOT FDIC Insured NOT Guaranteed by the Bank MAY Lose Value NOT Insured by any Federal Government Agency NOT a Deposit Subject to Risk

350 West Main Street, Richmond

Loans subject to credit approval. centralbank.com

Wealth Management Services are provided by Central Bank & Trust Co. CBIA, Inc., dba Central Insurance Services (CIS), is a wholly-owned subsidiary of Central Bank & Trust Co. Insurance products, investment products and securities:

Around here, people help make life easier for their neighbors. And Central Bank can make getting a mortgage easier and often faster with

competitive rates and exceptional personal service. To find out more, call Donna Haney at 859-625-6502

or email [email protected].

Mortgage Originator I.D. 493923

NMLS I.D. 440304Member FDIC

Spring into Wellness with Essential Oils!

Wondering what all the essential oil hype is about? Are you new to essential oils? If you are interested in learning more about essential oils then you will not want to miss this FREE workshop taking place

Monday, March 14th @ 5:30pm located at Glades Christian Church.

We will walk you through different oil stations where you can learn, explore and discover how Young Living’s Essential Oils can benefit

you and improve your families health and wellness. Tickets are FREE! Please register at: bereaspeedoiling.eventbrite.com

HOSTED BY: Carrie Sipple, Tasha Walters, Crystal Catron, Sarah Sams, Shelley Tucker, Misty Brock, Sandy Briggs, Angela Prewitt,

Stacey Mays, Blair Vorbeck, Sarah Foley, and Jessica Willis

When they first pur-chased the Dinner Bell, they knew they wanted to re-create the gift shop con-nected to the dining area, but they didn’t have a spe-cific idea. The plan started to take shape when Charles purchased Mitchell Tolle’s framing equipment from his old gallery.

“Mitchell had given me a ride to my house, be-cause one of my employ-ees needed a sawzall when we were loading up Mitch-ell’s framing equipment,” Charles said. “On the ride back I asked him if he would continue painting, and who would frame his

stuff if he did, since he was selling it all to me. Then it just kind of hit me to ask him if he would be inter-ested in selling his prints through the Dinner Bell.”

Tolle was intrigued by the idea, since his art had only been sold in galleries before, such as his own.

“People can be very in-timidated by art, and gal-leries,” Tolle said. “I like that the art will be in a restaurant, a comfortable place for people to come.”

Charles has purchased over 200 of Tolle’s prints, and his staff is currently framing them in prepara-tion for the grand opening of the gift shop. Tolle’s son, Mitchell Tolle, Jr., traveled down to teach them how to frame his father’s work – something he has worked on since his teenage years.

Tolle, who has not been able to paint much the past year, will be unveiling his new painting of the Boone Tavern at the open house in August. He has “always wanted” to do a painting of the tavern, and this will be his first one.

Selling her pottery through the Dinner Bell will also be a new experi-ence for Culbreth, who has traditionally been loyal to the Berea College retailers, such as the Log Cabin and Boone Tavern gift shop. When Marilyn first asked her about selling her art in the gift shop, Sarah was “humored.”

“I would never have con-sidered that,” Sarah said, “but I got involved, and it’s been an absolute de-light working with Charles and Marilyn.”

People who attend the open house will all receive a ticket for the clay bell that Sarah has crafted, and there will be a drawing at the end of the evening.

“To have a chance at it, you have to come that night,” Sarah said. “It is a stunningly gorgeous, spe-cial bell, not large and not small.”

The Dinner Bell store will also be selling arts and crafts from A Villager’s Hands, a fair trade non-profit that Jo Brosius from Berea started with her hus-band over two years ago. Jo, who has traveled to over 60 countries, started the organization because of the intense poverty she was seeing.

“People who live in this type of poverty have no way of getting out of it,” Jo

said.Jo has organized arts and

crafts groups in seven dif-ferent countries – Guate-mala, Indonesia, China, Vietnam, Kenya, Uganda, and Peru – and brings the items to the states to sell them. All profits made go back to the villages, which have already made goals on how to spend the mon-ey.

In addition to the local art in the gift shop, which includes Warren Brun-ner’s books, pieces from the art fellows in 123 Gal-lery in Old Town, Charles and Marilyn have a vision of a “Mass General type of store with less clutter.” There will be toys made from a Kentucky crafts-man, some primitive stuff, and other gift-giving items.

GIFTSCONTINUED FROM PAGE A1

Harding doing the print-ing process and color sec-tion.

Harned said that Luna Zorro is her breath of fresh air, but that in time she would like to go back and complete her degree in art.

Currently Luna Zorro art can be found locally at The Herb & Willow tea and coffee shop, as well as online at Etsy.com . Luna Zorro is located at 408 Chestnut St. Berea, Ken-tucky. For more informa-tion visit them on Face-book or call 859-302-2584.

LUNACONTINUED FROM PAGE A1

Berea Art Fellows currently working at The Gallery 123 in Old Town Artisan Village showed their wares at the Ken-tucky Crafted market last week.

Kentucky Crafted is the Kentucky Arts Council’s signature arts marketplace for wholesale buyers and the general pub-lic. The marketplace was held from March 4-6 at the Lexington Convention Center.

“For more than 30 years, artists in the Kentucky Crafted Program have rep-resented the best of the Commonwealth’s art and craft produc-tion on local, state, national and interna-tional stages,” said Lori Meadows, exec-utive director of the arts council. “Ken-tucky Crafted artists contribute mightily to the Commonwealth’s global association with artistic excel-lence and quality

craftsmanship.” Gallery 123 was

among the state’s fin-est producers of art, craft, literature and artisanal food partici-pating in The Market, which offers buyers from galleries, shops and online retail ven-ues across the nation the opportunity to select products from this elite group of ex-hibitors.

The Market was open exclusively to the trade on March 4. From March 5-6, the marketplace opened to the public.

In addition to shop-ping for fine art and craft, visitors enjoyed musical performanc-es, sampled regional food products, par-ticipated in hands-on activities, and ex-plored Kentucky arts and culture through special exhibits.

Gallery 123 is a project of the Arts Accelerator Program sponsored by Berea Tourism. The emerg-

ing new artists were selected to receive business training, studio space and oth-er support through-out a sixteen month fellowship to support their artistic and pro-

fessional skills. By stocking and man-aging the program’s gallery, the emerging artists are upholding the legacy of Berea’s Craft Economy and preparing for their

careers as working artists.

For more informa-tion about Gallery 123 Emerging Artist Studio, call 859-986-2540 or email [email protected]<info@

visitberea.com> . Visit us online at gal-l e r y 1 2 3 b e re a . c o m For more informa-tion about Kentucky Crafted: The Mar-ket, visit http://artscouncil.ky.gov/

Thursday, May 8, 2014 Page B1

King’s Eye Care






PLANS ACCEPTED

Find a Physician844.303.WELL (9355)

KentuckyOneHealth.org

Why do you need a Family Doctor?Of course your primary care doctor treats you when you’re sick, but your doctor is also never shy about giving advice on staying healthy and providing preventive services such as tests, screenings and immunizations.

Simply, your doctor is here for you, 24/7.

Call our physician referral service and our experts can help find the best doctor for you and your family.

Cari Slatten said, “Ellen Burke from Berea College because she is my

adviser and I work for her. She always does the most to help her students out

and be supportive.”

Chase Christopher said, “Miss Strong from Shannon Johnson

Elementary because she always lets me play and tells me to read.”

By Critley King/The Citizen

AR

TS


Arts CalendarPublic Reception for the Community Art Show and

Young at Art ExhibitSaturday, March 12Berea Arts CouncilExhibit by local artists will be displayed from March

11 to April 16. Reception will take place from 2 - 4 p.m.

Madison County Dulcimer Group SessionMonday, March 14Intergenerational Center, behind Russel Acton

Folk CenterNo experience necessary. Join in the jam from 1 - 2

p.m. with beginners, and 2 - 4 p.m. with intermediates.

Berea College Country Dancers ConvocationWednesday, March 16Seabury Upper GymOpen to the public, no charge. From 8 - 9:30 p.m.

Della Mae performs Vibrant Sounds Honoring the Roots

Thursday, March 17Berea College Phelps-Stokes AuditoriumThe five versatile female vocalists draw from rootsy

influences to create original music.

Performance of Jeff Richey ExperienceFriday, March 18Berea Center for the ArtsFrom 7 - 9:30 p.m., local rock band Jeff Richey Experi-

ence will perform. Admission is $5 at the door.

25th Annual Authors Brunch & Silent AuctionSaturday, March 19Boone TavernFrom 10 - 12:30 p.m., featuring poet George Ella Lyon

and Lucy Flood reading works of her father, Charles Flood. Tickets - $25. Call 859-623-5832.


Like Us On

(859) 986-0175208 Pauline Drive, Suite F PEOPLES

BANK

“Who is your favorite teacher

and why?”

Amanda Joy said, “I would just like to give out shoutouts to all the Berea

College professors in general. One professor gave me money to apply to law school and three are going out of their way to write recommendation

letters for me in one week.”

Emerging Artists Exhibit at Kentucky Crafted

Submitted PhotoLocal artists participating in the Arts Fellow program through Berea Tourism exhibited at Kentucky Crafted: The Market 2016 this past week. Pictured from left to right are Jarod Cox, Gerald Price, Bethany Butters, Cory Shenk, and David Scriviner.

The Chieftains Perform with Berea College Students

The Chieftains, an inter-nationally renowned tradi-tional Irish band, and the Berea College Folk-Roots Ensemble joined forces in a concert on Wednesday, March 9, at the Eastern Kentucky University Per-forming Arts Center in Richmond.

The Dublin, Ireland-based Chieftains were looking for a group to sing at their concert as part of their American tour.

Elizabeth DiSavino, di-rector of the Berea Col-

lege Folk-Roots Ensemble, volunteered the group of Berea College students, in-cluding Jay Callahan, Blake Durham, Adam Hudson, Jonathan Kemp, Joseph Muth, Julie Nelms, Tyler Rosso, Michelle Watson-Jones, Whitney Worthing-ton and Jared Zanet. Using Appalachian music as its touchstone, Berea’s Folk-Roots Ensemble branches into other kinds of tradi-tional and roots-based mu-sic.

The Chieftains, who

formed their band in 1962 in Dublin, have popular-ized traditional Irish music around the world. They of-ten collaborate with well-known guest artists in their concerts from a wide range of musical styles, such as Roger Daltrey, James Gal-way, Art Garfunkel, Mick Jagger, Tom Jones, Madon-na, Willie Nelson, Luciano Pavarotti, Earl Scruggs, Ricky Skaggs, Sting and The Rolling Stones.




NEWSPAPER








Local News

M A R R I A G E S

B A P T I S T H E A L T H B I R T H S

February 13Kendra Michelle Yar-

ber, 28, Irvine, disabled, to Christy Sue Cutright, 35, Irvine, unemployed

February 20Kaitlynne Renee Smith,

23, Berea, day care, to Da-vid Emerson Orr, 23, Berea, student

February 26Katrina Rosalea Parks,

19, Canada, Ky., student, to Tyler Austin Stump, 19, Phelps, night watchman

Justin Lee Mullins, 20, Berea, laborer, to Candace

Nichole Chasteen, 21, Berea, cashier

February 27Terri Duvall Scales, 55,

Richmond, accountant, to Hobert Dwight Griffin, 58, Richmond, accountant

February 29Emily Rose Land, 19,

Richmond, veterinary tech, to Colbert Thomas Gau-treaux II, 33, Richmond, assistant superintendent

March 2Alisha Dawn Hunter, 31,

Paint Lick, unemployed, to Stevie Ray Saylor, Jr., 31,

Berea, line manShelli Justina Foster, 21,

Richmond, homemaker, to Jordan Daniel York, 23, Richmond, disabled

March 3Misty Renee Vest, 41,

Waynesburg, self-em-ployed, to Jerry Wayne Naylor, Jr., 40, Waynes-burg, disabled

March 4Lois Fay Townsend, 55,

Richmond, unemployed, to Daniel Mitchell Schnei-der, 66, Richmond, retired



he was in there!

Join in the hunt!


monthly drawing to



An historical treat will be offered to Bereans at the end of this month, when Boone Tavern hosts a dra-matic portrayal of John Gregg Fee.

On March 29 at 10 a.m., Obadiah Ewing-Rouse will perform a dramatic portrayal of John Gregg Fee, “Abolition . . .Amen!”

John G. Fee (1816-1901) was the founder of both Union Church of Christ (an anti-slavery, non-de-nominational church) and First Christian Church in Berea. He also planted the seeds for what would be-come Berea College. John G. Fee was a fighter for social equality throughout the country until his death in 1901. He is buried in the Berea Cemetery.

The Retired Disciple Ministers and Spouses, in cooperation with The Ken-tucky Humanities Council, invite the public to attend this dramatic presentation.

As the son of a slave-holding father, John Gregg Fee witnessed firsthand the benefits of having slaves and the profits that could be made from their labor. When he gradu-

ated from college and en-rolled in Lane Theological Seminary, Fee began to understand the inherent wrong and destructiveness of slavery. He was deter-mined to become an abo-litionist and work for the immediate end to slavery. Feeling betrayed, his fa-ther took him out of school and forced John to return home. Rather than staying in the North. Fee commit-ted his life and work to ending slavery and dis-crimination at home in Kentucky.

Fee’s anti-slavery efforts garnered the attention of Cassius Clay, a prominent politician and outspoken emancipationist from Ken-tucky. Their relationship became hostile when they couldn’t agree on how to go about ending slavery.

Fee Portrayal to Take Place Fundraiser for

TEAM DEXTON

Gospel Singing, Silent and Live Auction,50/50 Raffle, Free Food and Drink

Dexton is a one year old little boy, the son of Paul and Denise May. He was diagnosed with Wiskott Aldrich Syndrome back in July. He went through extensive chemotherapy and a bone marrow transplant which started on December 1st at Cincinnati Children’s Hospital. Dexton and his mom and dad are currently having to stay in Ohio for Dexton’s treatments. Family and friends are hoping to help raise money for medical and living expenses. So please come out and help someone from the local community.

Where: Climax Volunteer Fire DepartmentWhen: March 19th at 5:00 pm

Music by: Friends of Faith Frymyer Family Hall Family Timberline Road

Madison MileFamily Fun Walk

Register to win prizes!

SundayMarch 202:00 pm - 4:00 pm

Canned food is being collected by theMadison County Retired Teachers Association

Two Locations: Berea: Farristown Middle School Richmond: Caudill Middle School

Please bring canned foods for local food banks.

Rain (inside gym)Shine (at the track)

CelebratingBe a Children’s

Champion Month

Corporate SponsorGet Fit (2 Family Memberships)

Sponsors Providing PrizesDick’s Sporting Goods

Soft Shoe - Lexington LegendsMeijer - Golden Corral - Kroger

Galaxy Bowling Center

February 2A daughter was born to

Wendy and Joshua David-son of Mt. Vernon

February 3A son was born to Beth-

any and Chad Warner of Berea

February 4A son was born to Kait-

lynn and Matthew John-son of McKee

February 5A son was born to Jaime

and William Turner of Ir-vine

A son was born to Chris-tina and Benjamin Mohler of Richmond


Ciara D. Hellard of Rich-mond

A son was born to Briana Hudson and Taylor Isaacs of Richmond

February 12A daughter was born

to Ashley Broderick and Cody Rachford of Rich-mond

February 16A son was born to Ange-

lika and Robert Barstow, Jr., of Richmond

A daughter was born to Kacie and Brandon Crowe of Irvine


Laura and Lester Sparks of Waco

February 18A son was born to Dean-

dra Strange and David Ray of Irvine

A son was born to Am-ber Miller and Brandon Bullock of Orlando


Laura Osborne and Travis Charles of Beattyville

A daughter was born to Amanda Bowen and John-nie Culton of Richmond

A daughter was born to Lillian Williams and Nel-son Townsend of Rich-mond

A daughter was born to Chelsey and Jacob Doyle

of IrvineFebruary 21A son was born to Chris-

tina and Ian Root of BereaFebruary 23A son was born to Cait-

lyn and Kyle Farra of McK-ee

A son was born to Ariel Ikhmayes and Brian Tip-ton of Irvine

A son was born to Gruna Kathiri and Prem Natara-jan of Richmond

February 25A son was born to Kelly

Ferron and Steven Hupp of Richmond

February 26A son was born to Ash-

ley and Tim David of Rich-mond

February 28A son was born to Amy

and Andrew Hiatt of TynerFebruary 29A son was born to Nata-

sha and James Moore, Jr., of Richmond

WOR

D S

EARCH


SUDOKU ANSW

ER:CROSSW

ORD ANSWER:

Answer: Daniel Gillies

Answer: Alia Bhatt

Answer: Theo Walcott

Answer: Tamar Braxton

Answer: Marvin Humes

March 13–19

Guesswho’s


I was born on March 14, 1976, in Winnipeg, Manitoba,

Canada. I play Elijah Mikaelson on The Originals.

Who am I?

I was born on March 15, 1993, in Mumbai, India. I played Veera Tripathi in

Highway. Who am I?

I was born on March 16, 1989, in Stanmore, London, England. I was named BBC Young Sports Personality of the Year in 2006. Who am I?

I was born on March 17, 1977, in Severn. MD. I

co-host The Real talk show. Who am I?

I was born on March 18, 1985, in Greenwich, London, England. I was a member of

JLS. Who am I?

ABOVEATLASBACONBLUESBURROWCAGEDCANADACRAYONSDELAYEAGLE

ERASEEVENTEXTRAORDINARYGIANTGLASSGOOSEINTERNALINTERPRETATIONLONDONMELTS

MERRYMOUTHNOTIONOLIVEORIGINPARTSPEOPLESPERCHPOURINGPREDICT

PRISMRAGINGRELIEFREPLYRIDERRISINGSANDYSINGSSINKINGSPINE

STEAMEDSUFFIXSUNNYTHIEFTHREATTOWELTRIBALUSINGVALUESWOMEN

CROSSWORD PUZZLE

ACROSS

1. BATHROOM ITEM6. DOWN UNDER15. HIGH WATER-PROOF BOOT16. ENTWINING17. ARAB LEADER18. SUGAR SUBSTITUTE19. BALLPOINT, E.G.20. HARD TO MISS22. VICTORIAN, FOR ONE23. GAIT BETWEEN WALK AND CANTER25. FLY, E.G.26. FLUFF28. BLACK IGNEOUS ROCK30. PUT IN32. NITROGEN COM-POUND33. AT LIBERTY34. FOOT38. SMARTER, CLEVERER40. ONE WHO DISTRIB-UTES CHARITY42. “TRICK” JOINT

43. NUMBER ONE45. AGREEING (WITH)46. RIOT48. RUSSIAN WRITER49. ___ BEAN51. PINOCCHIO, AT TIMES53. SUPERGARB54. MATTERHORN, E.G.55. SENT UNWANTED EMAILS58. BACK MUSCLE, FAMILIARLY59. PSYCHOMOTOR DISTURBANCE61. CIRCA

63. SET OF THINGS TO HELP FORM A CONCLU-SION64. SPOIL, WITH “UP”65. COUSIN OF THE FLUTE (PLURAL)66. ALLEVIATED

DOWN1. REARWARD ANGLED2. ONE WHO TAKES

PHOTOS3. COMPONENT OF NUCLEIC ACIDS4. “MALCOLM X” DIREC-TOR5. BLOWS IT6. BRIDAL PATH7. OF LESS WISDOM8. CONFECTIONARY OR CANDY9. FRESHMAN, PROBABLY10. FAZE11. “___ MARIA”12. FLAX FABRIC13. DEAD TO THE WORLD14. CITY ON THE YAMUNA RIVER21. APPROPRIATE24. BUILDING WHERE HIDES ARE TANNED27. INANE29. “FANTASY ISLAND” PROP31. ___ CANTO33. INDEPENDENT WORKER35. INCONSISTENT, IR-

REGULAR36. CESSATION OF MEN-STRUATION37. PROMOTED MILITARY RANK39. “CHICAGO” LYRICIST41. MORE, IN MADRID44. LIKE A SNAIL, BUT WORSE47. BREAK TIME48. “___ WE HAVING FUN YET?”49. DRUDGE50. KIND OF NERVE52. ACCUMULATE54. MAPLE GENUS56. DUCK’S HOME57. BROAD VALLEY60. “MUCH ___ ABOUT NOTHING”62. ___ CONSTRICTOR

Puzzle 1 (Easy, difficulty rating 0.39)

5 6 2 1 3 4 7 9 88 1 4 5 9 7 2 6 33 7 9 2 6 8 5 4 17 8 6 4 5 9 3 1 24 2 3 8 1 6 9 7 59 5 1 7 2 3 4 8 66 4 5 3 7 1 8 2 92 9 8 6 4 5 1 3 71 3 7 9 8 2 6 5 4

SUDOKU


AND INFORMATION

CALL SHEILA JOHNSON

986-0959

CryptoQuiz

She was the first woman to fly solo across the Atlantic:

____________________________________

Answers: 1) Kansas, 2) Canary, 3) Ninety-Nines, 4) Electra, 5) Disappearance, Amelia Earhart

Each of the following cryptograms is a clue to the identity of a woman in history. Using the hints O=A and F=N, decipher the clues to name the woman.

G O F M O M___________

S O F O Q Z___________

F E F W D Z – F E F W M______________________

W R W S D Q O______________

P E M O T T W O Q O F S W________________________

3

2

4

5

1

Whiten Your Smile

Help a Child

Family & Cosmetic DentistryJones

Most insurance accepted DrMelissaJones.com

Melissa Jones, DMD


Two Ways You Can Help1

2

Whiten Your Smile!March-June, whiten your teeth at a discounted fee (donation) and 100% of the money goes tohelp children in our community!

Donate $1000We’ve set a goal to raise at least $1000 this year in additional donations, apart from teeth whitening. Please donate at least $10 next time you visit our office.

Our practice’s Partner Affiliate

5 3 7 9

9 7 2 3

4

4 5 9 1 2

3 1 9

9 5 7 2 3

4

2 8 6 4

3 7 8 4











®-NO BULL-


Come See the

































































































REPLACEMENT RENTALS


(859) 986-7712


(859) 986-7595


(859) 985-2596


(859) 985-7371





office (859) 986-1802








“The highest form of worship is the worship of unselfish Christian service. The greatest form of praise is the sound

of consecrated feet seeking out the lost and helpless.”

-- Billy Graham

P-CAB

986-1111




“Of course there is no formula for success, except perhaps an unconditional acceptance of life, and

what it brings.”

-- Arthur Rubinstein


(859) 985-5577



[email protected]



































• TOPS (Take Off Pounds Sensibly), 6:15 p.m., Berea Baptist Church. For details, call Carol at 859-575-0173.






• Fiscal Court, 9:30 a.m.

• Berea Elementary School SBDM Council, 3:30 p.m., elementary confer-ence room.















Regular meetings

Calendar of eventsMarch 10• Story Time, 10:30 a.m., Madison County Public


• Free afternoon movie, 3:30 p.m., Madison County Library in Berea. Showing Peanuts.




March 12• Public reception for the Community Art Show

and Young at Art Exhibit, 2 - 4 p.m., Berea Arts Council. Exhibit by local artists will be displayed from March 11 to April 16.

• Honey Hill Farm Indoor Petting Zoo, 1 p.m., Madison County Public Library in Berea by the fireplace. Will include exotic chickens, guinea pigs, ducks, chinchillas, and more.


• Felted Easter egg ornaments demonstration, 10:30 a.m. - 3:30 p.m., Kentucky Artisan Center. Tonya Vance to demonstrate.

• Author Jim Shields of Lexington to sign new children’s book, Welcome Baby Bunnies!, 11 a.m. - 2 p.m., Kentucky Artisan Center.

March 12• Lenten Lunch, 12 p.m., Parish House at Berea

United Methodist Church. Will begin with special music, followed by the speaker, Pastor Mike Pow-ers, from Lexington First United Methodist Church. Lunch will then be served.

• Gospel Singing, 6 p.m., Lighthouse Baptist Church on Gabbardtown Road. Featuring New Har-vest from Tenn.

March 13• Meet-the-Artists Reception, 1:30 - 3 p.m.,

Kentucky Artisan Center. Artists from the center’s exhibit, Great Impressions: Prints by Kentucky Arti-sans to be present.

March 14• Annual Meeting for Sustainable Berea at First

Christian Church. Dessert at 6:30 p.m., and meet-ing at 7 p.m. Speaker from Chicago Botanic Garden will speak on “Edible Landscaping: Beauty and Bounty in Your Yard.” Baked goods auction at 8 p.m.

• Yoga for Every Body -- Free Yoga Classes, 9:30 a.m., Madison County Public Library in Berea. Free, beginner-level class, taught by certified instructor Carrie Mahoney. Must register -- 986-7112.

• Madison County Dulcimer Group Session, 1 - 4 p.m., Intergenerational Center, behind Russel Acton Folk Center. No experience necessary. Join in the jam, 1-2 p.m. with beginners and 2-4 p.m. with intermediates.

• Lego Club, 3:30 p.m., Madison County Public Library in Berea. For ages 6 through 14.


March 15• Blood Drive, 11 a.m. - 5 p.m., Union Church in

Community Room. Call 800-775-2522 to schedule.• Baby and Toddler Time, 10:30 a.m., Madison

County Public Library in Berea. For ages 0 - 2 1/2.• Toddler Tuesday, 10 a.m. - 12 p.m., Russel Ac-

ton Folk Center. Free for 0 - 4 years old, adult must accompany child.


• AppalSeeds Heirloom Seed Starting Work-shop, 6 p.m., Madison County Library in Berea. Learn how to plant from seed, save seeds, and transplant seedlings. Participants will also receive heirloom seeds. Must register -- 986-7112.

• Workshop on Urban Gardening: Make the Most of the Space You Have, 7 p.m., Madison Coun-ty Public Library in Berea. Horticulturist Lisa Hil-genberg from Chicago Botanical Garden discusses gardening in limited space.

March 16• Berea College Country Dancers Convocation,

8 - 9:30 p.m., Seabury Upper Gym. Open to the public, no admission charge.


• Basic Spanish for Adults, 6 p.m., Madison County Public Library in Berea. Hispanic Outreach Project (HOP) at Berea College is teaching a ten-

week Spanish course at the library.• Crafternoon: Making Tissue Paper Stained

Glass, 3:30 p.m., Madison County Public Library in Berea.

March 17• Berea College convo -- Della Mae performing

Vibrant Sounds Honoring the Roots, 8 p.m., Phelps-Stokes Auditorium. The five versatile female in-strumentalists and vocalists draw from rootsy influences to create original music.


• Free afternoon movie, 3:30 p.m., Madison County Public Library in Berea. Showing Alvin and the Chipmunks, Rated G.


March 18• Camera Club, 5 p.m., Madison County Public

Library in Berea. All shutterbugs welcome.• Libraraoke, 6:30 p.m., Madison County Public

Library in Berea. Fun of karaoke w/o hangover.• Performance of Jeff Richey Experience - local

rock band, 7 - 9:30 p.m., Berea Center for the Arts. Admission - $5. Tickets at the door.

March 19• 25th Annual Authors Brunch & Silent Auction,

10 a.m. - 12:30 p.m., Boone Tavern. Featured au-thors - George Ella Lyon and Lucy Flood present-ing works of her late father, Charles Flood. Tickets - $25; call 859-623-5832 by March 17 to reserve.

• Pie Auction for the Kentuckians For The Com-monwealth (KFTC), 6 - 8 p.m., Union Church. Cost - $5 for adults; free for 12 and under, or if pie is brought. Call 859-358-9713 for more info.

• Berea Writers Circle, 1:30 p.m., Madison Coun-ty Public Library in Berea.


• Berea Welcome Center Carvers Demonstrate, 10:30 a.m. - 3:30 p.m., Kentucky Artisan Center.

March 20• Family Fun Walk, 2 - 4 p.m., Farristown Middle

School at the track. Madison Mile a part of Chil-dren’s Champion Month. Bring canned foods for local food bank. If rain, will be in the gym.








8:00 a.m.- 4:30 p.m.

BIG ONCOMMITMENT

AutoFarmHome


Business






Perhaps I can help.




BURRIS

PLUMBINGI N S T A L L A T I O N & R E P A I R S

Water heaters, faucets, outside spigots. Experienced, Licensed, Dependable.

Call (859) 986-3928, 302-2030 (cell)127 Plaza Drive, Berea

986-2777



Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



The Smith Group










save the dates




2016

8 & 9

From February 26 to March 3, 2016

Meridian Partners LLC, 876 Development LLC to Luxon Contracting LLC, 621 Fairfax Lane in Rich-mond, $29,000

Marian B. Carroll to Fed-eral National Mortgage Association, 111 Jonathon Drive in Richmond, release of liability owed by the grantor under the terms of the promissory note dated April 6, 2006

Payne Homes Inc. to Lar-ry L. Oliver, Vicki L. Oliver, Tract, Madison County, $266,477

Richard Eppley to Jamison A. Rogers, Greg-ory J. Rogers, 606 Prospect Street in Berea, $58,500

Kevin McQueen, Amy Hawkins to Douglas A. Lakes, Lot 2, Apple Grove Park Subdivision in Berea, $57,000

Fannie Mae Federal Na-tional Mortgage Associa-tion to Thomas Ray Wil-son, 1028 Raintree Drive in Richmond, $123,000

Sherri M. Eden to Pa-mela J. Williams, Unit 301 Wilmore Park Condomini-ums, $145,000

B and B Homes Com-pany Inc. to Stephen Hen-drickson, Amelia Hen-drickson, Lot 56, Burnells Homestead, $175,000

Secretary of Housing and Urban Development to Wilson Associates Inc., 206 Vanhook Court in Berea, $82,450

Flossie R. Hill to Joyce A. Harrison, Jonathan Rid-dell, 2107 Dreyfus Road in Waco, $8,000

Sadie Clemmons to Beth-el Lee Parker, Lot 12 Rob-binswood Subdivision, gift from parent to child

Helen P. Chenault, trustee, Helen P. Chenault

Revocable Trust to Wil-liam Russell Weddle, Vir-ginia C. Weddle, Unit 257 Grey Oaks at 257 Clair-mont Drive in Richmond, $268,500

Primo Properties LLC to Myranda L. Peterson, John E. Peterson, 256 View Point Drive in Richmond, $205,000

John E. Peterson, Myran-da L. Peterson to Donna Prater, 320 Wisteria Court in Richmond, $144,500

Tommy Cope Proper-ties LLC to Blake Sheaks, Brittany Sheaks, 156 Bryson Way in Richmond, $180,000

Ramsey and Ramsey LLC to Signature Rentals LLC, property beginning at corner of Wayne and Maryland Drive, $750,000

Ramsey Rentals LLC to Signature Rentals LLC, 235


SEE PROP, PAGE B7

Madison County Detention CenterFrom February 27, 2016

to Marcy 4, 2016

February 27Michael Williams, 38,

Berea, giving officer false name or address, theft of identity of another with-out consent, two counts of contempt of court, failure to appear

Andrew Delgado, 31, Paris, fourth degree assault – domestic violence, third degree terroristic threaten-ing, second degree unlaw-ful imprisonment, third degree criminal mischief, first degree robbery

Ashlee Burgin, 27, Rich-mond, serving parole vio-lation warrant

Sarah Ritenour-Hogue, 28, Berea, first degree pos-session of controlled sub-stance, theft of identity of another without consent, serving bench warrant for court

William Moore, 32, Rich-mond, operating motor ve-hicle under the influence of alcohol or drugs, operating on suspended or revoked operator license, posses-sion of open alcohol bev-erage container in motor vehicle prohibited

Nikki Haik, 28, Rich-mond, public intoxication of controlled substance

Carolyn Eckler, 35, Rich-mond, non payment of fines

Jimmy Combs, 20, Rich-mond, non payment of fines

Tena Kelly, 42, Rich-mond, failure to appear

Carter Bowling, 28, Berea, two counts of failure to appear

February 28Brandon Jones, 24, Som-

erset, operating motor ve-hicle under the influence of alcohol or drugs, failure to produce insurance card, possession of open alcohol beverage container in mo-tor vehicle prohibited

MacKenzie Mulloy, 20, Richmond, failure to ap-pear

Nicholas Kates, 21, Berea, public alcohol intoxication

Casey McKiddy, 28, Richmond, public alcohol intoxication

Samual Stephens, 29, Lexington, public in-toxication of controlled substance, first degree possession of controlled substance – heroin

Angela Tipton, 36, Ir-vine, falsely reporting an incident

Amy Bingham, 35, Rich-mond, failure to appear

Josh Owens, 28, Rich-mond, failure to appear

Gary Kelly, 69, Berea, failure to appear

February 29

Sonda Mize, 42, Rich-mond, non payment of fines

Rebekah Moran, 39, Richmond, non payment of fines

Jonathan Collier, 27, Har-rodsburg, probation viola-tion

Jerri Lakes-Deaton, 28, Richmond, parole viola-tion

Valarie Ward, 26, Rich-mond, probation violation

Brian Hatcher, 32, Berea, public intoxication of con-trolled substance

Anthony Owens, 28, Mt. Sterling, fourth degree as-sault – domestic violence, violation of a Kentucky EPO/DVO

Johnny Hacker, 55, Rich-mond, theft by unlawful taking – shoplifting under $500, third degree criminal mischief, second degree disorderly conduct, theft by unlawful taking

Devin Coffey, 20, Irvine, theft by unlawful taking – shoplifting between $500 and $10,000, first degree possession of controlled substance

Jacab Henry, 21, Irvine, theft by unlawful taking – shoplifting between $500 and $10,000

Brittany Hiatt, 27, Rich-mond, buy/possess drug paraphernalia, illegal pos-session of legend drug, serving bench warrant for court

David Snyder, 33, Mt. Vernon, public intoxication of controlled substance, second degree disorderly conduct

Richard Lemaster, 28, Ir-vine, non payment of fines

Tara Coffey, 19, Irvine, theft by unlawful taking – shoplifting between $500 and $10,000

March 1Crystal Allen, 39, Rich-

mond, contempt of courtJames Potter, 34, Rich-

mond, probation violationJoseph McKeithen, 30,

Richmond, failure to ap-pear

Amanda Davenport, 39, Richmond, contempt of court

Robert Still, 39, Rich-mond, fourth degree as-sault – domestic violence

Jeffery Burgett, 38, Rich-mond, hold for court

Floyd Moore, 22, Paint Lick, two counts of third degree terroristic threat-ening, two counts of con-tempt of court, first degree fleeing or evading police, first degree wanton en-dangerment, failure to produce insurance card, reckless driving, failure to report traffic accident

Darian Perkins, 21, Ma-son, Ohio, operating motor

vehicle under the influence of alcohol or drugs

Ricky Fansler, 48, Rich-mond, failure to comply with sex offender registra-tion, persistent felony of-fender

Aaron Ferrell, 26, Rich-mond, violation of condi-tions of release

Joseph Chesnut, 25 Rich-mond, theft by failure to make required disposition of property

Ameia Singleton, 35, Richmond, contempt of court, second degree bur-glary, three counts of fail-ure to appear, tampering with prisoner monitor-ing device, second degree criminal mischief, theft by unlawful taking between $500 and $10,000

Angela Sizemore, 32, Mt. Sterling, non payment of fines, failure to appear

Patricia Mays, 46, Berea, second degree wanton endangerment, public in-toxication of controlled substance, non payment of fines

Brandon Smith, 34, Berea, hold for court

Robert Lear, 32, Brod-head, public intoxication of controlled substance, second degree disorderly conduct, resisting arrest

Keith Cates, 44, Rich-mond, public intoxication of controlled substance

Kerry Seaborne, 53, Berea, first degree pos-session of controlled substance, third degree possession of controlled substance, buy/possess drug paraphernalia, sec-ond degree wanton en-dangerment, public in-toxication of controlled substance

Heather, 34, Irvine, fail-ure to appear

Danny Rose, 42, Irvine, non payment of fines

David Nester, 44, Rich-mond, theft by unlawful taking, theft – receipt of stolen credit/debit card, theft of legend drug, con-tempt of court, theft by un-lawful taking – shoplifting under $500

Lori Palmer, 30, Berea, hold for court

Lauren Mansfield, 27, Ir-vine, hold for court

Rebel Roser, 30, Berea, operating motor vehicle under the influence of al-cohol or drugs, failure of non-owner operator to maintain required insur-ance, first degree wanton endangerment

March 2Shawn Saylor, 25, Paint

Lick, failure to appear, buy/possess drug para-phernalia

Timothy Baker, 50, Berea, contempt of court, first de-

gree burglary, third degree criminal mischief, fourth degree assault – domestic violence, second degree disorderly conduct, public alcohol intoxication

Ryan Walton, 41, Rich-mond, contempt of court

Brianna Holliman, 28, Richmond, receiving sto-len property under $500, theft by deception – in-clude cold checks under $500

Tacoma Gullion, 25, Richmond, public intoxica-tion, contempt of court

Anthony Clemmons, 32, Richmond, serving bench warrant for court

Michele Brown, 38, Rich-mond, second degree hin-dering prosecution or ap-prehension

Billy Johnson, 32, Berea, public alcohol intoxication, second degree disorderly conduct

Keisha Gibson, 32, Berea, public intoxication of con-trolled substance

Kendra Hussong, 25, Berea, violation of condi-tions of release

Robert Girdner, 35, Rich-mond, public intoxication of controlled substance, failure to appear, two counts of non payment of fines

Thomas Carpenter, 36, Berea, theft by unlawful taking – shoplifting under $500, third degree crimi-nal trespassing, violation of conditions of release, two counts of first degree possession of controlled substance, tampering with physical evidence

March 3Robert Short, 29, Rich-

mond, public alcohol in-toxication

Jullian Johnson, 32, Waco, second degree bur-glary, theft by unlawful taking – between $500 and $10,000

Alicia Pruitt, 32, Rich-

mond, operating motor vehicle under the influence of alcohol or drugs, first degree possession of con-trolled substance – heroin

Preston Peters, 48, Lex-ington, carrying a con-cealed weapon

Preston Peters, 29, Rich-mond, failure of non-own-er operator to maintain required insurance, op-erating on suspended or revoked operator license, possession of handgun by convicted felon

Kenneth Sizemore, 29, Richmond, failure to ap-pear

Lora Noble, 56, Berea, theft by unlawful taking

Angela Hampton, 37, Berea, violation of condi-tions of release

Josh Bogie, 30, Berea, theft by unlawful taking – shoplifting under $500, violation of conditions of release

Michael Whitt, 28, Berea, fraudulent use of credit card under $500 within six month period

Matthew McGinnis, 33, Huntsville, Ala., failure to or improper signal, care-less driving, no other state registration receipt, failure to produce insurance card, operating motor vehicle under the influence of al-cohol or drugs, first degree possession of controlled substance, buy/possess drug paraphernalia

Dora Lewis, 45, Berea, violation of conditions of release, first degree pro-moting contraband, first degree possession of con-trolled substance – meth-amphetamine

Erica Combs, 30, Rich-mond, violation of condi-tions of release

Thomas Fryer, 35, Rich-mond, violation of condi-tions of release

Karen Still, 40, Rich-mond, violation of condi-

tions of releaseMelissa Jones, 31, McK-

ee, theft by unlawful tak-ing – shoplifting under $500

Shawndra Chasteen, 44, Mt. Vernon, failure to ap-pear

March 4William Alexander, 20,

Richmond, serving bench warrant for court

Michael Jacobs, 26, Berea, failure to appear

Nicole Curtis, 28, Nicho-lasville, operating motor vehicle under the influence of alcohol or drugs, first degree wanton endanger-ment

Paul Dunaway, 29, Rich-mond, theft by unlawful taking – shoplifting under $500, first degree wanton endangerment – police of-ficer, first degree promot-ing contraband, buy/pos-sess drug paraphernalia, probation violation

Amanda Little, 31, Rich-mond, first degree wanton endangerment, endanger-ing the welfare of a minor, first degree possession of controlled substance – co-caine, buy/possess drug paraphernalia, second degree possession of con-trolled substance

Curtis Richardson, 31, Richmond, first degree wanton endangerment, en-dangering the welfare of a minor, buy/possess drug paraphernalia

Daniel Fryer, 37, Rich-mond, violation of condi-tions of release

Josh Owens, 28, Rich-mond, theft by unlawful taking – shoplifting under $500

Billy Shearer, 44 Berea, possession of handgun by convicted felon, theft by unlawful taking – firearm

Jeffrey Tarter, 21, Berea, failure to appear

William Livergood, 54, Richmond, failure to ap-pear

Phillip Duff, 41, Berea, contempt of court


Senior Closet Sale Saturday March 19th

8am3pm @Berea Community Gymnasium

Name brand teen and kid clothes

Prom, shoes and

Formal wear

gently Used Books

Bedding

Jewery

& furniture

All Proceeds goes to BCHS Project Graduation

MONEY FOR FARM IMPROVEMENTS AVAILABLE…

COUNTY AGRICULTURAL INVESTMENT PROGRAM (CAIP)

Applications will be available for Madison County’s CAIP to assist farmers in making important on-farm investments. Application Period: March 7 – March 25, 2016 No applications will be accepted after March 25, 2016. Application Availability: Madison County Conservation District Monday – Friday (8 a.m. – 4:30 p.m.) For More Information: Contact at 859-624-1981 x 3 or email [email protected]. All applications are scored, based on the scoring criteria set by the Kentucky Agricultural Development Board.

Madison County Conservation 1024 Ival James Blvd. Suite A1

Richmond, KY 40475 624-1981 x 3 855-706-7039

[email protected]


PROPCONTINUED FROM B6

the


BereaContact us:

[email protected]

In Person:711 Chestnut Street

Suite 2

By Mail:P.O. Box 207

Berea, KY 40403

By Phone:859.986.0959

By Fax:859.986.0960

February 29Rachel Marie Hollaway vs. Theodore Scott HollawayQuintin Danielle Warford vs. Melissa Marie WarfordCabinet for Health and Family Services Ex Re.: Nevaeh A. Belfridge vs. Amanda McConnaugheyDirk Grose vs. Melissa K. GemmerMarch 1Cabinet for Health and Family Services Ex Re. Stephanie Allison Re: Jerimiah AllisonMarch 2James Richard Adair II vs. Erica Renee AdairLisa Renee Wolfinbarger vs. Tracy Edward WolfinbargerToni VanWinkle vs. Jonathan VanWinkleSheila Housholder vs. Bart HousholderTracy Short vs. Shelby ShortMarch 4Cabinet for Health and Family Services for Bertha S. Hester vs. Landis HesterChad Robert Blackburn vs. Teresa Dale BlackburnHuapei Chen vs. Stephen Roger SizemoreSharon Sue Frazier vs. Steven Frazier

Domestic and Family cases filed in Madison Co. Circuit Court between Feb. 29, 2016 to March 4, 2016:




622 Chestnut Street




I can help you get the coverage you need.People who switched to Allstate saved money and gotmore protection. Which means they’re better prepared forthe mayhem that can happen everywhere. So don’t wait!Call me today.

PAUL REYNOLDS(859) 986 8484REYNOLDS INSURANCE AGENCY, [email protected]

Coverage and savings based on policy features selected and are subject to terms, conditions and availability. Allstate Property and Casualty Insurance Company: Northbrook, IL. © 2010 Allstate Insurance Company

Wayne Drive in Richmond, $2,330,000

Ladonna Rae O’Bryan, James Elliot O’Bryan Betty Keathley, Sandra Keath-ley, Peyton Newby, Tracts, Madison County, $130,000

Lisa Hall to Habitat for Humanity of Madison and Clark Counties, Kentucky Inc., Tract, Madison Coun-ty, in lieu of foreclosure of the mortgage dated Au-gust 10, 2011

Tanya L. Crum, Ted L. Crum to JBRO Holdings LLC, Lot 38, Welling-ton Place in Richmond, $110,000

Carolyn L. Hisle, Jean Hisle to Lawrence J. Green-well, Guadalupe Green-well, Lot 1 and 2A Hill Crest Subdivision near Richmond, $138,000

Scott R. Rockwell to De-nise Weiss Salinas, Tracts in Madison County, near Webb Road, $157,000

John Lazzaro, Michelle Lazarro to WW Invest-ments LLC, Lots 3 and 4, Interstate Business Center, $265,000

Ball Homes LLC to Bethanie D. Tucker, Mark

A. Tucker, 165 Prim-rose Circle in Richmond, $249,346

Childers Construction and Fencing Inc. to Orville Martin Jordan, Janna E. Jordan, 149 Tuscany Way in Richmond, $255,280

Derby Chase Develop-ment LLC to LP Construc-tion LLC, Lot 33, Derby Chase Subdivision in Rich-mond, $27,000

David Reynolds, Sharrie Reynolds to John B. Mar-cum, Jr., Kayla E. Lewis Marcum, Lot 188, Shi-loh Pointe Subdivision, $243,000

Kondaur Capital Corpo-ration as separate trustee of Matawin Ventures Trust 2012-3 to Hershel Anglin, Abby Anglin, 1756 Lan-caster Road in Richmond, $128,500

David A. Bruyneel, Bev-erly J. Bruyneel to Mark Tyler Maynard, 112 Brad-ley Drive in Richmond, $95,000

Snapp Homes and Rent-als LLC to Davis H. Reeves, Natasha L. Reeves, Lot 48 – 49 Deacon Hills Subdivi-sion off Barnes Mill Road, $138,000

Jack Maupin, Edna Carol Maupin to Mary F. John-son, Lot 21, Stateland Sub-division, $138,000

Boyd L. Gambrel, Jr., Robin Gambrel to Ben Mo-bley, 1045 Trevor Drive in Berea, $137,000

Danny K. Jones, Oma L. Jones to Mod Squad Prop-erties LLC, 504 Orange Street in Richmond, $1

Leah Simpkins, Leah Cornelison, Brian Simp-kins to Heather R. Spauld-ing, 235 Susan Drive, $125,000

Primo Properties LLC to Donald Curtis Wilhoit, Tract, Madison County, $88,000

James Kenyon, Susan Kenyon to Jason S. Van-Winkle, Brandi E. VanWin-kle, Lot 83, Crossing Sub-division, $115,000

321 Shafor LLC to James Cameron Cannon, Lot 14, Edgewood Subdivision, $149,000

Mark Wilds, Patti Wilds to David Reynolds, Shar-rie Reynolds, Lot 16, Tra-ditions at Parkey Falls, $389,000

BKS Properties Inc. to Ron Day, Mia Day, 173 Me-ridian Way in Richmond, $174,405

Fannie Mae Federal Na-tional Mortgage Associa-tion to Matthew McDaniel, 206 Bonnie Drive in Rich-mond, $175,000

Jerry Leo Richardson to

Randall Winkler, Rebecca Winkler, 290 Burton Lane in Richmond, $15,000

Bethany N. Brashears to Jeffrey L. Brashears, Bar-bara J. Brashears, Lot 56, Argyll Woods Subdivision in Richmond, $129,000

Charles Russell Davis, Karen A. Davis to Andrew Thomas Gambrel, Lau-ren Ashton Gambrel, 202 Crimson Drive in Rich-mond, $273,000

Celia Rubio, Davina Jes-sica Rubio, Amanda Rubio Lobo, AIF, David Rubio, Maria De Refugio Delga-dillo Ramirez, Romel Lobo to George Winkler, Janie Winkler, 2450 Old US 25 in Richmond, $30,000

Michael Albright, Jamie Albright, Jamie Becker to Jeffrey Holliday, Char-monin Chaney, 141 Wes-ley Court in Richmond, $149,000

KJC Properties LLC to Commonwealth of Ken-tucky Transportation Cabi-net Department of High-ways, Tracts on Glades Road, $23,000 (US 25 Wid-ening project)

Paul Schultz, Sammae Schultz to Jennifer Rebecca Dobrzynski, 409 Drayton Place in Richmond, love and affection

K & L Developers Inc. to

Charles F. Bowling, Mary S. Bowling, 606 Four-winds Drive in Richmond, $45,000

Richard M. Poling, Car-rie Brennan Kennedy Pol-ing to Kenneth A Meyer, trustee, Drina B. Meyer, trustee, Kenneth A. Meyer and/or Drina B. Meyer, trustees, Drina B. Meyer Trust, Lot 28, Western Hills Subdivision off Mule Shed Lane, $174,000

Nicole Leonard, Mar-tin Leonard to Wendell Combs, Diana Combs, Tract, Madison County, agreement between the parties

Farmer & Resch Devel-opments LLC to Jeremy L. Bellamy, Bill Bellamy, Lot 10 College Park Sub-division in Richmond on Barnes Mill Road, $135,000

Jenn Burton to Michael B. Manhanke, Wanda C. Manhanke, 793 Scaf-fold Cane Road in Berea, $62,500

Community Trust Bank Inc. to Closet & Casework of Kentucky LLC, 525 Blue Spruce in Richmond, $20,000




By Kayla WeaverMadison Southern Eagle

For Madison Southern senior Dakota Bender, Congenital Heart Defects (CHDs) has had a bigger impact on him than most 18-year-olds.

Throughout February 26-29, Dakota helped raise more than $150 through a Krispy Kreme doughnut drive. With two cousins who have been affected by this defect, Dakota’s family has long been a part of the CHDs community. A char-ity that is dear to them is Kerrington’s Heart, an or-ganization that helps fami-lies affected by the defect.

“Heart disease can not only hurt the children with it, but the family as they watch their loved ones suf-

fer,” Dakota said, “Those kids are Heart Warriors with all the heart defects they endure; what’s funny is they have some of the best hearts emotionally. These kids deserve better so I hope we all can come together to bring better awareness to CHDs so we can help fight and end this.”

These defects have been known to show signs as early as birth. CHDs af-fect the heart with heart rhythm problems, heart failure, stroke, develop-ment delays, and if not treated properly, may end in death. For a child to be diagnosed with CHDs their heart has to have been born with an abnormally structured heart and/or large vessels.

Impacting one in every 100 persons; an average of nearly 40,000 babies are born every year in the Unit-ed States with this defect, with roughly 1.8 million adults living with it. Cur-rently, there is no cure for CHDs and many organiza-tions have been created to raise money for research to find a more powerful stability for those affected. These organizations also help support families af-fected by the defect by helping with medical bills and treatments that are used to keep their children alive. If the defect is caught early on, parents are faced with the decision of put-ting their child through multiple heart procedures. Even after procedures, pa-tients could face life long

struggles with cardiac is-sues.

February happens to be Heart Health month where schools around Madison County took part in promoting healthy liv-ing. Through Kerrington’s Heart, Dakota and those like him help raise money and awareness by hosting drives at Zumba classes and also at the Wild Hearts 5-K Run that is held yearly in Lexington.

With a defect that im-pacts more than just the people it harms, hope is running high for the fami-lies of Congenital Heart Defects and hope is some-thing we all need.

For more information about Congenital Heart Defect or how you can help visit kerringtonsheart.org.

MSHS Senior Brings Awareness to CHDs

At Regional individu-al competition at Boyle County High School, Madison Southern wres-tlers took home medals. Joey Scribano at 160 took home second place, Sam

Kauer at 170 took home fourth place, Fatu Sevelo at 195 took home third place, and Justus Williams at heavyweight took home second place.

Southern Wrestlers Place at Regional

UK Players Visits Fans at Berea Health Care

Jarrod Polson, a UK Wildcat bas-ketball player from 2010-2014, visited some lifelong, die-hard UK fans last

month at the Berea Health Care and Rehabilitation Center, after speaking at Berea United Methodist Church’s

Lenten lunch. Pictured with Jarrod is Lonnie Clark, Wanda Prater, Mabel Turner and Helen Diaz.



At the Girl Scout inves-titure service on March 5, 1956, recipients of sec-ond-class pins were Merle Weeks, Dianne Giffin, Jean Grossman, Anne Hadley, Gracia Chin, Carol Cruse, Linda Wear, Linda Essary, Nita Byrd, Sandra McClel-lan, and Trudy Gilkerson.

Tenderfoot badges were awarded to Merle Weeks, Nita Byrd, Margaret Weeks, Trudy Gilkerson, and Polly Downs. New brownies who received pins were Linda Rae Coyle, Lee Carol Hahn, Pat Ho-bein, Susan McAfee, Jane Carol Rogers, and Joan Carol Williams.

Proficiency badges were given to Jeraldine Hughes, Betsy Wright, Julia E. Smith, Leeann White, Bar-bara Gulkler, Dona Clare Hougen, Helen Bibbee, Christine Hopkins, Mari-lyn Kindel, Sandra For-tune, Nora Ruth Allen, Louise Boggs, Janet Lou-ise Britton, Marion Cox, Sharon Kirk, Margaret Pugsley, Claire Ross, Rose Mary Rogers, Rosemarie Taylor, Ann Cruse, Molly Lou McAfee, Helen Hovey, Jennie Whiteaker, and Jane Carol Singleton.

The Berea City Council prohibited the city’s fire engines to go outside city limits at their meeting in early March, because of the Kentucky Inspector Bureau’s warning. The Bu-reau wrote that “regular municipal fire department organization . . . should not be weakened by hav-ing any of its members respond outside the city limits. The apparatus re-sponding to rural areas must be manned by fire-men who are not members of the municipal organiza-tion.”

The council also ap-proved the levying of fines from $25 to $100 on people who were so negligent in taking care of their grass or trash fires, that the fire de-partment had to be called.

It was shocking in March 1956 when the No. 1 rated Berea Pirates basketball team fell to the Madison Central Indians 63-60 at Regionals in Lexington. Berea, however, was play-ing without regular for-ward, Dorse LeMaster. This was the first time in four games that the Indi-ans were able to beat the Pirates.

The Berea Pirates re-ceived the 44th District Basketball Tournament trophy at Eastern State College. Team members in-cluded Phil Ed Hammond, David Singleton, Don Mills, Dorse LeMaster, Jimmy Williamson, Darrell Bicknell, Maurice Walker, Johnny Eades, Billy Jen-nings and John Earl Stiver.

The Berea D.A.R. chapter

met at the home of Mrs. W. G. Best and Mrs. Wilson Evans for a potluck dinner. Guests were Mr. and Mrs. Rolf Hovey, Mr. and Mrs. William Blackburn, Mr.

and Mrs. William Dean, Mr. and Mrs. H. H. Hays, Mr. and Mrs. Clyde Jones, Wilson Evans, Lucille Ste-phens and Carol and Sallie Stenken.

Twelve girl scouts received first class pins at the investiture service held on March 5, 1956 in the Berea High School Auditorium. From left to right in the front row are Dona Clare Hougen, Helen Bibbee, Leeann White, Jeraldine Hughes, and Christine Hopkins, who were members of Troop 1 under the leadership of Mrs. Gordon Ross and Mrs. Leon Sanborne. In the second row are members of Troop 2, Nora Allen, Janet Louise Britton, Louise Boggs, Marga-ret Pugsley, Rosemary Rogers, Rose Marie Taylor and Ann Cruse. Mrs. Wilson Evans and Mrs. Robert Boggs were the leaders of the troop. Leaders in the back row are Mrs. Raymond Drukker, Mrs. Richard Hougen, Mrs. Evans, Mrs. Boggs, Mrs. Sanborne, Mrs. Paul Hadley, Mrs. Ross, Mrs. Jerome Hughes, and Mrs. Corban Goble.

American Association of University Women, Berea

25th Annual Authors Brunch & Silent Auction Saturday, March 19, 2016 10:00am– 12:30pm

Coyle Gathering & Lincoln Rooms, Boone Tavern - 100 Main St. Berea

Photo credit Jennifer Munson

Charles Bracelen Flood

& daughter Lucy Flood

Tickets are $25 and can be purchased from Wednesday, March 3 - Thursday, March 17 Call 859-623-5832 or email [email protected]

AAUW’s Mission and Diversity Statement The American Association of University Women promotes equity for all women and girls, lifelong education and

positive societal change. In principle and practice, AAUW values and seeks a diverse membership. All proceeds go toward scholarships for women.

Honored as Kentucky Poet Laureate for 2015-16, George Ella Lyon is on a mission to find a poem from every county in her project “Where I’m From.” Lyon first began writing poems in elementary school. While attending Centre College in Danville, Kentucky she dis-covered that writing was what she loved most during her study of English and music. Her love for music and words have been an inspiration to many as she teaches the impact and power that words have in expressing and connecting the hearts of both readers and writers.

“Though I write in many forms, I am first of all a poet; which means my job is to see and sing the connections between things. The spider’s web is a delicious image for this and for the wonder of something newly made from old patterns, like the sentences writers spin each day. The strength of my web comes from family, friends, words, music, dreams, mountains, and the joy of making. Think about the life you are spinning and how you could write about its different strands. “

George Ella Lyon

Charles Bracelen Flood was the author of fifteen books, many of which were critically acclaimed, including Lee: The Last Years and First to Fly: The Story of the Lafayette Escadrille. He wrote a number of books on historic figures, including Robert E. Lee and William T. Sherman. His short pieces were published in magazines, including The New Yorker, The Atlantic and Esquire. The Washington Post had this to say about Grant and Sherman– The Friendship That Won the Civil War, it was “beautifully defined and explored… a powerful and illuminat-ing study of the military collaboration that won the war for the Union.” “Mr. Flood’s versatility is impressive…” wrote New York Times Janet Maslin.

Flood graduated from Harvard and was a member of Archibald MacLeish’s noted creative writing seminar. He was a past president of PEN America Center and served on the governing bodies of the Authors League and Authors Guild. Flood was born and raised in New York City, spending much of his life there. Much later in life he lived with his wife, Katherine, in Richmond, Kentucky until his death in 2014.

Lucy Flood will be presenting works of her late father Charles Bracelen Flood. She is an editor specializing in helping writers and art-ists ignite their creative fire, and write from the heart of their artistic inspiration. She lives with her husband in the Bay Area and enjoys writing at dusk on the patio of her favorite creek-side café. One thing she misses about Kentucky is watching fireflies flash against a dark sky. She is the author of the forthcoming novel The Way Minnows Kiss.

Berea Drug has served Berea and the surrounding area for almost 40 years.We are family owned/operated & remain committed to our customers with fast,

friendly service. Stop in today & see what we can do for you!For more than 40 years Berea Drug has

served our customers with a level of compassion & caring that’s unmatched.

If a family oriented Pharmacy is what you’re seeking, please consider

Berea Drug.

402 Richmond Road NorthBerea, KY 40403(859) 986-4521

www.BereaDrug.com

Walk-ins welcomeor call ahead.

Kentuckians for the Commonwealth (KFTC) will hold their 6th annual Pie Auction on Saturday, March 19 from 6 - 8 p.m.

The event will be held at Union Church, and will

include fun activities for all ages. The cost will be $5 for adults, and free for children 12 and under. Stu-dents cost $3.

There will be a talent show, and people who sign

up can get in free; people who bring a pie for the auc-tion will also get in free.

Call 859-358-9713 for more information.

KFTC Hosts 6th Annual Pie Auction

THURSDAYMarch 17,

2016Vol. 116, Issue 41


Inside





Our Staff

Teresa Scenters,

Publisher

Beth Myers,

Editor

Kim Kobersmith,

Critley King

Reporters

Keeley Johnson,


Sheila Johnson,

Advertising

Timothy Pack,

Graphic Design

50¢ Newsstand

Plac

e m

ail l

abel

her

e

Contact Us



Ph:859-986-0959Fax: 859-986-0960


B1



Berea Community students “glean” food for needy

families

Conflict Between City & Chamber Heats Up Over

Spoonbread Festival


Baptist Health Rich-mond has recently pur-chased land at Interstate Exit 77 from Rodney Short, with the plan to “invest in the health of Berea.”

The Richmond hospital purchased 14 acres, and at this point, according to Marketing and Public Re-lations Coordinator Megan Tracy, they are not positive how they will use the land.

“We are looking at the fu-ture health needs of Berea, and we will be exploring the best use of the land,” Tracy said.

Baptist Health has been interested in broadening their health services to Berea for a while, Tracy said. Hospital leadership will be seeking to meet with the different stake-holders in Berea, to inves-tigate the needs and wants of the community.


If the weather cooper-ates this April, Berea Com-munity science students will be launching a high altitude weather balloon to near space, with experi-ments tagging along for the ride.

“The scale of this project

is something the students simply do not see, and the excitement and enthusi-asm in the class reflects that,” Joshua Woodward, the teacher of the 9th grade Honors Integrated Science class at Berea Community, wrote on his gofundme page.

Woodward has been working on this project

with his freshman stu-dents since January. They posted the project on the gofundme page in order to raise the necessary funds to purchase the needed equipment for the balloon launch, which includes the balloon, helium, cam-era equipment, construc-tion materials, and mate-

SEE LAUNCH, PAGE A9


Decorum and calm slowly eroded at Tuesday night’s city council meet-ing, as tempers rose when members of the Berea Chamber of Commerce and Bereans United for Social Justice (BURJ) both argued their agendas be-fore the council.

On point for both groups was the Spoon-bread Festival -- the fall event that the Chamber implements every year -- and whether Confederate flag merchandise could be sold by the festival ven-dors. Mayor Steve Con-nelly had issued a draft contract to the Chamber of Commerce earlier this year, with several chang-es including a restriction against the selling of Con-federate flag items.

Connelly indicated at the end of the city council

meeting that he was will-ing to negotiate or forgo most of the suggested changes in the draft con-tract, but he would stick to the restriction that Confederate memorabilia could not be sold on city property. In the 19 years that the Spoonbread Festi-val has been held in town, the Berea Chamber has used city property around Berea Memorial Park for no charge.

Earlier, Berea Chamber President Jennifer Napier stated that the chamber would consider not ap-plying for the $5,000 they usually receive from the Berea Tourism Commis-sion, in order to forgo the signing of the appropria-tions contract. But Con-nelly replied that the ban on Confederate items would be in place for any group that licensed to use

Council Reviews Final Drawing

of $10.4 Million City Hall

SJE Academic Team Puts in Championship Season

SEE CONFLICT, PAGE A9

Joshua Woodard works with his 9th grade students at Berea Community as they run experiments on the “payload” they’ll be

sending up to space in mid-April. The Honors Integrated Science class has been working since January on a weather balloon they’ll

send into space attached with a camera. The balloon will go up approximately 100,000

feet before it pops and comes back to earth.

Berea Science Class Prepares for April Launch of Weather Balloon


The final drawings of the new Berea City Hall, Fire and Police station complex were presented to city council at their work session on Tuesday.

The complex, which city staff have estimated may cost over $10 million, would include training and office space for the police and firefighters, as well as new space for the financial office that would include a drive-through for paying bills. The City of Berea has received a $500,000 grant specifically for the fire station portion from the Community De-velopment Block Grant, and they may borrow the rest of the money from Rural Development with a ceiling rate of 3.125.

“Rural Development will be bidding on the

project, and they told us that would be the ceiling rate. They may go down depending on the market, but it won’t go up,” Berea City Administrator Ran-dy Stone said, who fur-ther reported that Rural Development would give them a 40 year loan.

Since Rural Develop-ment will only release the money when the project is 80 percent done, the city will need to secure interim funding as well. Construction of the new city complex, Stone said, should take approximate-ly 18 months.

Mayor Steve Connelly, City Clerk Cheryl Chas-teen, and Stone will be moving to the Berea Mu-nicipal Utilities building in May, and Economic De-velopment Director Dan-ny Isaacs will move to the

Baptist Health Hospital Purchases Land at Exit 77 By Beth Myers

Citizen Editor

Shannon Johnson El-ementary School is proud-ly displaying their four trophies, recently won by their fourth and fifth grade academic team.

The team won Districts this year, beating Berea Community, Kirksville, and Silver Creek, and placed third overall at Re-gionals. Prior to this year, no Shannon Johnson team scored so well.

In Districts, Madilyn

Sizemore placed first in composition, and Bella Moberly placed fourth; Camilla Julian placed fourth in arts and hu-manities; Mollie Blevins placed fourth in language arts written assessment; Isaac Moore placed fourth in social studies writ-ten assessment; Mason Himes placed second in science written assess-ment and Brady Fields placed fourth; and Alex Kling placed first in math written assessment with Madilyn Sizemore placing

fourth.Their future problem

solving team placed sec-ond at district, and they placed first with quick re-call.

In Regionals, the team placed third in quick re-call, and third in future problem solving. Alex Kling placed third in math written assessment, Isaac Moore placed second in social studies written as-sessment, and Camilla Ju-lian placed first in arts and

SEE SJE, PAGE A10

SEE CITY, PAGE 10

The Shannon Johnson Elementary Academic Team had their best season ever this past semester, racking up the Overall District Champions this winter, and then placing third overall at Regional competition. In the back row, left to right, are Coach Deanna Burnett, Jacob Briggs, Mason Himes, Bella Moberly, Lessie Clemmons, Channing Catron, Alex Kling, Cayden Fee, Mollie Blevins, and Coach Jennifer Morris; middle row are Iris Chen, Madi-lyn Sizemore, Hayden Hazelwood, Riley Ritchie, Claire Cress, Trenton Allen, Brady Fields, Camilla Julian, and Canaan Mays; and front row are Lukas Mullins, Lauren Short, Kennedy Barker, Anna Parker Harris, Cameron Hechemy, Hadlee Todd, and Hunter May.







Obituaries from local funeral homes are printed free in the Berea Citizen

as a courtesy to our readers.



(859) 986-8416 • 1-800-307-0463



Owner


Owner



James Simpson Barnett

James Simpson Barnett, 71, of McKee, passed away on Thursday, March 10, 2016 at St. Joseph East Hos-pital in Lexington.

Mr. Barnett was born in Powell County to the late Simpson and Dolly Sparks Barnett. He served his country in the United States Army, and loved woodworking. He worked as a carpenter and machine operator for Red River

Hardwoods.Mr. Barnett is survived

by his wife, Anna Barnett of McKee; his son, James Simpson Barnett II of McKee; his brother, Lonnie Barnett of Clay City; his sisters, Jan Jacobs of India-napolis, Sue Smith of Clay City, Sharlet Scott of Lex-ington, and Mattie Nunan of Winchester; his sister-in-law, Ava Barnett of Clay City; and many nieces and

nephews. He was preced-ed in death by his siblings, Clinton Barnett, Loretta Stevens, Melba Gabbard, and Eileen Hoskins.

Funeral services for Mr. Barnett were at 1 p.m. on Monday at the Davis & Powell Funeral Home with Bishop Wesley Foister of-ficiating. Burial was in the Madison County Memorial Gardens. www.davisand-powellfuneralhome.com

Jesse Ray Bowman, 66, husband of Mary Evelyn Bowman, died Thursday, March 10, 2016 at his home in Lexington. He was born in Morrill to Esther Lamb Bowman and the late Ar-nold Bowman.

Jesse was a retired Uni-versity of Kentucky em-ployee. He worked at the physical plant and grounds for 49 years.

Jesse was preceded in death by his father, Ar-nold; his nephews, Don-ald and Timmy Clark; his nieces, Sharon Abrams,

Patricia Davidson, and Hope Clark; his paternal and maternal grandpar-ents; and his father-in-law, Levi Frank Engle.

Jesse is survived by his wife of 47 years and seven months, Mary Evelyn En-gle Bowman; his children, Charlotte (Donnie) Davis and Melisa (Jeff) Whis-man; his grandchildren, Alisa (Kevin) Moody, Tif-fany (Josh) Thomas, and Alison Whisman; his great grandson, Cayden Ryan Moody; three brothers and five sisters; and a host of

nieces and nephews. Funeral services were

Sunday, March 13, 2016 at 2 p.m. Burial was in the Clark Cemetery in Jackson County. Pallbearers were Derick Bowman, Kevin Cornett, Shane Yarber, Bryan Anderkin, Randy Anderkin, and Wayne Anderkin, and honorary pallbearers were Kevin Moody, Josh Thomas, and Cayden Ryan Moody. On-line condolences at www.lakesfuneralhome.com.

Wetona Elizabeth Isaacs

Jesse Ray Bowman

Rebecca Kay Greenwell, 54, of Berea passed away Tuesday, March 8, 2016.

Rebecca was a mother to all children, and happiest when surrounded by their laughter and smiling faces. She was fast to make friends and would go out of her way to help her family, friends, and neighbors. Quick to recognize an unfulfilled need, she would compas-sionately provide assistance and love. She held a rever-ence for nature and all animals, whether it be tending to her many flowers and plants, collecting interesting stones found on her frequent nature walks, or stargaz-ing with a small fire surrounded by the outdoors and people she cared about.

Rebecca is survived by her husband of 35 years, George Patrick Greenwell; and three children, Bradley (Aera) Thomas Greenwell of Juneau, Alaska, Kelly (Bri-an) Marie Greenwell Isaacs of Berea, and Mary (Adam) Ann Hall of Richmond. She was a proud grandmother to Wyatt Greenwell, Gavin Isaacs, Avery Hall, Layne Isaacs and Colton Isaacs. Her five siblings also survive.

Rebecca was a rare combination of boldness and sass that was well tempered with love. She will be best re-membered, by family and friends, for her unshakable optimism, resilient strength and determined spirit.

There was a Funeral Mass at St. Clare Catholic Church on Saturday at 2 p.m., with a reception following. Da-vis & Powell Funeral Home is in charge of the arrange-ments. In lieu of flowers, the family requests that do-nations be made to the Compassionate Care Center in Richmond.

Wetona Elizabeth Isaacs, 64, passed away Wednes-day, March 9, 2016 at her home, surrounded by her loving family. She was born in Richmond Ind., to the late James Eugene Rogers and the late Myrtle Bowman Rogers. Her working career was in both manufacturing and truck driving.

Westona is survived by her son, Tim Isaacs; one brother, Jimmy F. Rogers; and a host of loving relatives and friends.

A memorial service will be held at Wetona’s residence on Thursday, March 17, 2016 at 5 p.m.

Online condolences may be left at www.lakesfuner-alhome.com

Rebecca Kay Greenwell

Richard L. “Rick” Combs, 57, of Brindle Ridge, passed away on Thursday, March 3, 2016 at his home following a long illness. He was born in Madison County on March 3, 1959, the son of Robert (Bobby) and Jean Wilson Combs.

Rick was a self-employed me-chanic. He and his wife, Kathy, were owners of Ricks Excavating and Ricks Towing and Truck Re-pair. Rick, who loved old classic cars and fishing, was also a member of Maple Grove Mis-sionary Baptist Church,.

He is survived by his wife of nine years, Kathy Par-sons Combs; four sons, Rodney and Amy Combs, and Eric and Bridget Barnes, both of Berea, and Adam and Sarah Parsons of Mt. Vernon and Blake Saylor of Lon-don; three daughters, Tabitha and Phillip Combs of Georgetown, Hilary Combs of Berea, and Traci Parsons of Mt. Vernon; three stepchildren, Becky and Randy Bullock, Clinton and Sherry Parsons, and Cathy and Larry Kaluzny; his mother, Jean Combs of Berea; and two sisters, Lesa and Larry Combs of Berea, and Kim and Steve Kellerman of Richmond.

Also surviving are three grandchildren, Summer Barnes, Eric Barnes, and Jayden Combs; special grand-children, Madeline Paige Parsons and Dillon Parsons; step-grandchildren, Will and Deanna Parsons, Sherry and Chris Whitt, and Allen Druin; and step great grand-children, Cierra and Camryn Druin, Bryan and Nykalya Whitt, and Christian and James Parsons. In addition to his father, Bobby Combs, he was preceded in death by his grandparents, and one brother, Bruce Combs.

Funeral services for Mr. Combs were conducted on Monday, March 7, 2016 at 1 p.m. at the Maple Grove Missionary Baptist Church by Bro. Jerry Owens. Burial followed in Saylor Cemetery.

Pallbearers were Eric Haycraft, Mike Williams, Blake Saylor, Ricky Healy, Clinton Parsons and William Par-sons. Honorary pallbearers were Adam Parsons, Chris Whitt, Robert Gregory, Chester Powell, Billy Anglin, Randy Anglin, Randy Bullock, Bubby Parsons, Joey Croucher, Clarence “Floppy” Blevins, and Larry Kaluz-ny. Please visit www.DowellMartin.com or Dowell & Martin Funeral Home’s Facebook® page to view Mr. Comb’s online obituary.

Richard L. “Rick” Combs

Triumph of the AgesAn Easter Celebration

Palm Sunday • March 20th • 7:00 p.m. Berea Baptist Church

Full Orchestra 75 Voice Choir

SALE......Going On Now! 75% Off

Suits Values To $39999 ......................Now $99.99Dress SlacksValues $55 to $86....................Now $1375 To $2150

Sport CoatsValues $12499 to $195 ..........Now $3124 to $4875

Not All Sizes Available

Napier Brothers Clothing & Shoes35 Public Square • Lancaster, KY 859-792-2535

� e Family of

Bobby and

RickCombs

wish to thankeveryone whohelped us thru

Bobby Combs

BornAugust 24, 1935

DiedFebruary 20, 2016

BornMarch 3, 1959

DiedMarch 3, 2016

Rick Combs

the tears and sorrow of giving uptwo beloved members of our family.



00859-986-3301222 E Haiti Rd.

COPE’S Garage

A3 The Berea Citizen Obituaries/Local News Thursday, March 17, 2016

Robert G. Harned

Dale G. Baker, 77, of Dreyfus, passed away Monday eve-ning, March 7, 2016, at the St. Joseph Hospital in Berea.

Mr. Baker was born on October 7, 1938 in Estill County, the son of the late Burnam and Gladys Hunter Baker. He was a retired, self-employed contractor.

Survivors include his wife, Eliza Allen Webb Baker; two sons, Paul Baker (Wendy) and Clifford Baker; four daugh-ters, Sharon (Charles) Spangler, Beverly (Lee) Risk, Gail (Stephen) Detwiler, and Jennifer (Mark) Gray; two broth-ers, Danny (Donna) Baker and Mitchell Baker; four sisters, Ruth Felty, Paulette (Gene) Gillam, Myrna (Wally) Hehr, and Shelia Kay Evans; eleven grandchildren; thirteen great grandchildren; several nieces and nephews; and a host of dear friends.

He was preceded in death by a grandson, Blake Baker; one brother, Noland Baker; and two sisters, Carolyn Brad-ley and Donna Gabbard.

Funeral services were conducted at 11 a.m. on Friday, March 11, 2016 at the Combs, Parsons & Collins Funeral Home with Bro. Gene Smith officiating. Burial followed in the Bark Road Cemetery at Dreyfus.

Pallbearers were Paul Allen Baker, Aaron Dale Baker, Austin Lee Risk, Mark Gray, Stephen Detwiler and Charles Spangler. Honorary pallbearers were Eugene Burns, Wil-liam “Tuffy” Roe, Tommy Gill, Arthur Rogers, Lee Risk, Gary Taulbee and Mike Knuckles. www.cpcfh.com

Dale G. Baker

Nora Jean Rose, 78, of Berea, passed away March 14, 2016 at the Terrace Nursing and Rehabilitation. She was a native of Bell County, the wife of the late Meril Rose, and the daughter of Gabriel and Prudy Brown Hoskins.

Nora was a loving housewife, and member of the Holiness faith at the Sand Gap Holiness Church.

In addition to her parents and hus-band, Nora was preceded in death by her siblings, Verna Asher, Charles Hoskins, Herman Ferry and Clayton Hoskins. Nora is survived by her children, Meril (Judy) Rose, Jr., Mel (Leah) Rose, Kathy McKinney, and Imogene (Larry) Bolin; nine grandchildren; and six great grandchildren.

Funeral services will be conducted at 2 p.m. on Thursday at Lakes Funeral Home. Burial will be in the Pine Grove Cemetery in Jackson County. The family will visit with friends on Wednesday, March 16 from 6 – 9 p.m. at the fu-neral home. Lakes Funeral Home is in charge of arrange-ments. Condolences may be left at www.lakesfuneralhome.com

Nora Jean Rose









To RSVP, Call (859) 986-2371

Holy WeekSt. Clare

Catholic Church622 Chestnut Street • Berea

at

Holy Thursday Mar. 24 7 pm

Good Friday Mar. 25 7 pm

Easter Vigil Mar. 26 9 pm

Easter Mar. 27 9 am Spanish 11 am

127 Plaza Drive • Berea, Kentucky • (859) 986-2777127 Plaza Plaza Plaza Plaza Plaza Plaza Plaza Plaza Plaza Plaza Plaza Plaza DDDDDDDDDDrrrrrriiiiiivvvvvvvveeee • Be • Be • Be • Be • Be • Be • Be • Be • Be • Be • Be • Be • Be • Berrrrrreaeaeaeaeaeaeaeaeaeaeaeaea, Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentu Kentuccccky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) ky • (859) 99999986-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-27786-277777777127 Plaza Drive • Berea, Kentucky • (859) 986-2777

Mitchell Tolle

Tater Knob Pottery

Gallery 123 ArtistsBooks by Warren BrunnerThe Villager’s HandFair Trade pieces

Featuring the Art of

Sarah Culbreth has designed a one-of-a-kind Dinner Bellwhich will be given to the winner of a drawing to take

place at the end of the evening.

The artist will be on hand to unveil a new work.

Don’tmiss it!


ANGLIN’SBODY SHOP




986-2492

Robert G. Harned, 93, died Friday, March 11, surrounded by his family. He was born August 21,1922 on the farm outside of Lebanon Junction. He died in the same house.

Bob was preceded in death by his parents, his wife of 53 years, two sisters, and his grandson. He is sur-vived by his sister, five children, seven grandchildren, and numerous nieces and nephews.

Bob attended school in a one-room schoolhouse on the family farm, and then graduated from Lebanon Junc-tion High School in 1941. He served his country during WWII, and was stationed in England with the 392nd Bomber Group of the U.S. Army Air Corps.

Following the war, Bob attended the University of Kentucky, and graduated in 1949. He remained a loyal UK fan. He returned to the farm, and married the love of his live, Ida Jane Lueddecke, in June 1957. They started Bullitt County Feeders Supply in Shepherdsville in 1959.

Bob was very involved both in the agriculture commu-nity, and in service to the wider community. He served in Bullitt County for many years on the following boards -- Farm Bureau Directors, Conservation District, Fair, Plan-ning and Zoning, and Health. He was also a member of the KY Home Pork Producers, Shepherdsville Lion’s Club and First Baptist Church of Lebanon Junction.

Bob will be missed by family, friends, and the commu-nity. Arrangements were by Kappel’s Funeral Home in Lebanon Junction. The funeral service was held at First Baptist Church of Lebanon Junction Monday on March 14 at 10 a.m., followed by internment at Lebanon Junc-tion Cemetery.

Tina Parker will be the featured artist at Berea Arts Council’s Conver-sation Café on Tuesday, March 22, at 6 p.m.

Parker will discuss her writing process, will read from her poems, and will celebrate the release of her book, Mother May I’s with refreshments and a raffle drawing for prizes donated by local artists.

Mother May I is a se-ries of linked narrative poems that explode the stereotype of the ideal mother as they explore the raw, bodily realities of childbirth and par-enting young children. The book begins in the midst of daily struggles that come with raising toddlers, and uses flash-backs in later poems to address the themes of miscarriage, infertility, childbirth, and the com-plexities of parenting. The result is a collection that highlights the dual-ity of joy and pain pres-ent in the every day, and the immediacy of death in the face of vibrant life.

Tina Parker started writing in the third grade with her first di-ary, a tiny red book with a lock and key.

“I kept it locked, too, and I even took a flash-light to write in the hall closet,” Parker said.

Parker grew up in Bristol, Virginia, and in the Southern Baptist church, where she was taught to be soft-spoken

and polite. The diary was a way to give voice to feel-ings she wouldn’t dare say out loud.

“The diary contains comebacks to my older brother that I thought of

hours later and tiny rants against my gym teacher who I wrote was ‘so mean’ because she made us play volleyball,” Parker said.

Parker now has two published books of poet-

ry—the full-length collec-tion Mother May I released in March from Sibling Ri-valry Press, and a chap-book Another Offering, published by Finishing Line Press.

Parker to Share Poems & Writing Process at Conversation Cafe





the


Berea


- Galatians 6:9







Letters from

BereaBeth Myers

Editor


From our readers

What Do You Know? Can anyone identify these

two dapper, Berea gentlemen in this photo from Warren Brun-ner’s collection?

Connecting the Dots


A couple of different readers identified the man in the middle of last week’s photo as William Mc-Clure from Mt. Vernon, a woodcarver who was a member of the Kentucky Guild. One reader said Mitchell Tolle once painted a picture of McClure.

Dear Editor,

A few months ago I at-tended a gathering in Frankfort bringing togeth-er leaders in health and housing to discuss issues of common concern and consider ways they might better work together to ad-dress them. The keynote speaker that day was the former Lt. Governor Crit Luallen. In speaking of the issues Kentucky faced she noted three concerns that served as impediments to progress. The first she cited was a failure to “con-nect the dots.” The second was the lack of sustained effort, and the third was the failure to consider the “consequences of inertia.” In short, I understood her to say that if we don’t look at how these issues link, who they will affect, and how they may affect them, the more costly things will become in the long run.

All the more reason why many in the “age-friendly” cities movement cite “look-ing (at your community) through an age-friendly lens” as essential to any comprehensive planning process.

That is why I was only somewhat delighted to learn in a recent Partner-ship for a Fit Kentucky arti-cle, of Berea’s commitment to “street makeovers” for walking and biking and the “institutionalization of

pedestrian safety as part of the Berea strategic plan.”

In the story, the mayor pointed out that the move-ment for street makeover started with one member of the planning commis-sion insisting that all new developments have side-walks. “At first,” he add-ed, “developers resisted because of the added ex-pense.” However, that all changed when “other voic-es” from the community, including representatives from public schools, law enforcement, city govern-ment, Cooperative Exten-sion Services, parents and the Bike Pedestrian Action Committee; AKA Berea Healthy Communities Board and a $146, 500 grant from the Kentucky Depart-ment for Public Health lent support for that commit-ment.

The city should be ap-plauded for listening to and responding to those “voices.”

It does however, raise other questions such as how many voices may not have been heard from in the planning process and how many more initiatives may actually be taking shape that are not taking into account the wishes of all of its intended audi-ence?

In speaking about the results from Berea’s first ever “age-friendly” survey in October, I said that the

findings could be viewed in one of two ways. The first might indicate that on many of the issues impact-ing “quality of life”, our city leaders and the Berea community have clearly different views regarding what needs to be done and what has been done.

One of the issues of con-cern raised in the survey results was the lack of pub-lic knowledge. (less than 22% of responders felt the city was doing a good job in providing that informa-tion). In the absence of knowledge to the contrary, the responses may reflect in part, the public’s percep-tion of what they believe is not taking place.

Knowing more about the committees charged with tackling these concerns and knowing who else may be working on similar quality of life issues could go a long way towards maximizing efforts to im-prove conditions for all of our city’s residents.

Sometimes connecting the dots begins with know-ing who, what, and where the dots are!

Are you aware of any other projects being worked on that would ap-ply to our “Age Friendly” movement? If so, let us hear from you.

Jeff RubinBerea

Dear Editor,

I’m pleased that Berea’s City Council has passed a resolution against intoler-ance and hate, in response to documented incidents in our community. This lays the foundation for the proposed Spoonbread Festival contract, which follows Kentucky State Fair guidelines by adding Confederate merchandise to the list of items already prohibited at the Festival.

I hope everyone can agree that Berea wants to promote itself as a wel-coming community. Busi-nesses which rely on the tourist industry count on

that. The fact is, regardless of the differing views of individuals, the Confed-erate Flag is perceived by many as a symbol of hate. Therefore, its presence at a festival supported by tax dollars and city services is the opposite of welcom-ing. My hope is that Berea would choose to consider the safety of all at any city-sponsored gathering.

Further, when institu-tions and political orga-nizations are seen as con-doning this symbol, there is evidence that it embold-ens people to act. This is the reason South Carolina decided to remove the flag from their state capi-

tol building after nine of their own were murdered in an act of hate. Surely, the Berea community will want to do everything in our power to prevent fur-ther harassment or vio-lence.

I encourage all mem-bers of Berea’s Chamber of Commerce to add their voices to this important community conversation. Our children are watching and learning from our ac-tions and our words.

Wendy Z. WarrenBerea

Don’t include hateful symbols at public events

Dear Berea Citizen.

Let’s see, some folks be-lieve there should be no restrictions on the selling of the Confederate Flag at Spoonbread because of freedom of speech and free market principles. I would propose that this rationale is based more on the types of materials being sold than the 1st Amendment and free market thinking.

Imagine if a booth was selling Nazi flags and paraphernalia; or litera-ture advocating Sharia Law with pictures of ISIS

flags and atrocities; or per-haps even more offensive, blatantly anti Christian propaganda, say, deviant pictures of Jesus Christ. These same folks would be out with shotguns run-ning these merchants out of town! And, I’d be there with them (without the shotgun).

Seems to me the is-sue boils down to what prism people are viewing the world through. Rebel flags may not be offensive enough to you to weigh against allowing them at the Festival, but they cer-

tainly would be to other citizens in our community.

Try putting yourself in the shoes of those African Americans, Jews and more who have witnessed the hatred represented by the KKK and others by wav-ing the Confederate flag and think how you would view it. Just because you are not offended, doesn’t mean it should be consid-ered acceptable.

Craig WilliamsBerea

Please make Berea a welcoming community

Dear Editor,

Free speech should not include hateful symbols at a public event, whether or not such event is on mu-

nicipal property.I pray there’d be a

ruckus if Nazi flags and memorabilia were sold. It should be the same way with confederate flags and

merchandise -- and any other hate-based items.

Dodie MurphyBerea

I lived in Washington D.C. for one year dur-ing college, and during that time there was one of those infamous gov-ernment shut-downs in the city, when Congress couldn’t get a federal bud-get passed. I remember Democrats and Republi-cans pointing fingers at each other on T.V., explain-ing why the other party was being completely un-reasonable, and why they couldn’t possibly get a budget passed until com-promises were made on the other side of the aisle.

Meanwhile, tourists and other city visitors were being interviewed, and they didn’t care what the political wrestling was about. They didn’t care about the principles in-volved, or why one politi-cal party felt they couldn’t give in on any point. What they cared about was get-

ting the Smithsonian Air and Space Museum open again, and they demand-ed that the legislature do whatever was needed to make that happen.

That’s how I’ve felt about the conflict between the City of Berea, and the Chamber of Commerce regarding the Spoonbread Festival, and the proposed regulation against the sale of Confederate flag mem-orabilia. I know there are grievances, principles in-volved with the Confed-erate flag, government vs. private enterprises, but ul-timately what I care about is having the Spoonbread Festival continue to be in Berea, and for the business and city leaders to work together.

This possible divorce be-tween the business com-munity and government of Berea over this festival has the potential to cause more damage to this town than the sale of hundreds of Confederate belt buck-les, and it has me very alarmed. Yes, there are some serious differences of opinions and values in this town, but our commu-nity won’t work if people pull up stakes when those

values crash into each oth-er. Just as children are al-ways the true losers in any divorce, the Berea people will be the true losers if the Chamber and City continue to knock heads until one of them breaks.

So I’m asking lead-ers from the city and the chamber to do whatever they have to do to keep the Spoonbread Festival in Berea, and that means making whatever com-promises are necessary. In other words, don’t just point to the other side and demand they give in.

Because if there is one thing that most everyone who lives in Berea agrees on, it’s this – that we love this diverse, ornery, split-apart town of ours, and we love our festivals. And we want the festivals here, in the city limits, with tourists visiting our local businesses, dang it. And nobody gets to divorce!

Surely that’s a good enough reason for the chamber and city leaders to settle down, and con-tinue to hammer out this thing until it’s resolved. Pretty please, with cherry on top, make it happen.

Keep Spoonbread Festival in Berea

Put yourself in the shoes of others



Della Mae Performs In Berea ThursdayThis Thursday evening,

the Grammy-nominated music group Della Mae will perform at 8 p.m. in Phelps Stokes Chapel at Berea College.

Della Mae, who recently performed on A Prairie Home Companion, will perform Vibrant Sounds Honoring the Roots. This convocation is a part of the Stephenson Memorial Concert Series and is free and open to the public.

Featuring five female instrumentalists/vocal-ists, the group formed in 2009, built a fan base with the release of their first album, I Built This Heart, in 2011 and broke through with the release of their 2013 Grammy-nominated album, This World Oft Can Be. In 2015, Della Mae released their

self-titled third album. According to The Blue-

grass Situation, “The praise was effusive even

before Della Mae was re-leased…The Boston Globe called the album master-ful.”

MULCH SALE$17 PER SCOOP

*No Limit whilesupplies last,

Sticks & Stones Landscape SupplyAnnounces It’s Annual Mulch Sale!

March 24th - 26th

We also have a large selection of decorative stoneHome of the Dirt Doctor (bulk Potting Soil)

DELIVERYAVAILABLE!

Sticks & Stones is locally owned & operated.

We are located at :

102 Springcircle Dr., Berea(1st street on right off N. Dogwood)

Phone: (859) 986-2985

Hrs: M-F 8:30-6:00Sat 8:30-5:00

Mulch sale is for dark hardwood only!

LARGEST SCOOP AVAILABLE!

plus tax

Lee Cox has been chosen as our February Employee of the Month. Lee has worked at The Terrace for almost seventeen years. She is a SRNA/Restorative Aide. When Lee was asked what she enjoyed most about working at The Terrace she stated; “I enjoy interacting with the residents. The most rewarding day is when I know the residents appreciate what I do, whether it’s walking with them for exercise or assisting them to an activity. I also enjoy my co-workers.” It’s a privilege to be named Employee of the Month. It’s nice to be recognized for my hard work and being dependable.” Director of Nursing, Patricia Dean, stated, “Lee is a great employee. She cares deeply for our residents. I’m proud to have her as part of The Terrace team.”

In her spare time she enjoys spending time with her family. She has two children, T.J. and Trey. She especially enjoys spending time with her four year old nephew, Matt. She enjoys taking pictures of family, her pets and places she travels to. She also enjoys working in flower garden in the summer. Congratulations – Lee!

The Terrace Names February 2016 Employee of the Month

whitesmemorial.weebly.com

Easter Sunrise Service7:15 a.m. March 27

White’s Memorial Presbyterian Church401 White Station Road, Berea, KY

Come out in the country to witness joy in the resurrection of Jesus.All are welcome. Light refreshments following worship.

This is a Berea Ministerial Association event.


622 Chestnut Street




Food Service Inspections for Week Ending March 4, 2016

Regular Inspections With No Follow-Up Due ScoreApollo Pizza & Beer, 228 S. Second St., Richmond 96%White Hall Elementary, 2166 Lexington Rd., Richmond 97%Berea College Food, 2 Scaffold Cane Rd., Berea 91%Foley Middle School, 275 Glades Rd., Berea 99%Shannon Johnson, 109 Oakwood Rd., Berea 96%Madison Middle School, 101 Summit St., Richmond 99%Madison Central High, 705 N. Second St., Richmond 98%Qdoba Mexican Grill #2444, 429 Leighway Dr., Richmond 95%D&G Sunoco, 1699 E. Main St., Richmond 98%Compassionate Care, 350 Isaac Dr., Richmond 100%Subway #744, 110 E. Water St., Richmond 100%Redi Mart #7, 2032 Richmond Rd., Richmond 91%The Manhatton Club, 221 E. Water St., Richmond 99%McAlister’s Deli, 620 E. By-Pass, Richmond 98%Papa Leno’s, 108 Center Dr., Berea 93%The Paddy Wagon, 150 E. Main St., Richmond 93%Days Inn of Richmond, 2109 Belmont Dr., Richmond 100%WMJ Shell, 1696 Northgate Dr., Richmond 100%

Regular Inspections With Follow-Up Due ScoreMcDonald’s #34957, 1001 Brandy Ln., Richmond 78% *Bagged milk was found not dated with use-by/discard date *Water excessively hot at handwash sink *Handwash sink not easily accessible due to clutter


Regular Inspections With No Follow-Up Due ScoreKingston Elementary, 2845 Battlefield Memorial Hwy, Berea 100%Waco Elementary, 359 Waco Loop Rd., Waco 99% The Olive Garden #1822, 2168 Lantern Ridge Rd., Richmond 96%King Buffet, 650 E. By-Pass, Richmond 87%The University Club A, 1510 Lex. Rd., Richmond 98%The Bounce House, 831 E. By-Pass, Richmond 96%

Regular Inspections With Follow-Up Due Score Chicks Wings Southern Style, 946 Red House Rd., Richmond 92% *No Sanitizer Found for ware washing Follow-Up Inspections With No Follow-Up Due ScoreMcDonald’s #34957, 1001 Brandy Ln., Richmond 98%


Meet Robert Ward, a sargeant with the Berea

Police Department.

When did you first con-sider becoming a police-man? What drew you to the profession? When I was about 20 years old. The

main thing that drew me in was public service. I just thought that was what I was meant to do.

What is the most reward-ing part of being a police-man? Changing someone’s life for the better.

What is the strangest sit-uation you’ve ever faced in your job? When I first began my career, I worked in a county jail. I remember being face-to-face and be-ing surrounded by inmates convicted of murder and other awful crimes. Needless to say, a strange and tense environment.

Tell us about your family. I have a wonderful, support-ive wife and four beautiful children. Also a beautiful niece we raise.

What is difficult about being a policeman? With-nessing personal struggles and tragedy. Also crimes against children.

Tell us something that most people wouldn’t know about you. I’ve al-ways had a deep love of music. I am the vocalist in a local band. We play quite a bit in Central Kentucky. I’ve been playing live for about two years now. Music has changed my life for the bet-ter.


DRIVEWAY GRAVEL haul-ing & spreading. Residential 859-544-7730 35x17p________________________BABYSITTING In my home near Silver Creek School from 6 a.m. -5 p.m.986-3095 41x1p


APARTMENT FOR RENT 1 BR, excellent location. Utilities included, $450/mo. $450 dep. No pets allowed. Washer/dryer hook-up. 859-314-4706. 39x4b________________________APARTMENT FOR RENT: Extra nice, 1 BR, quiet safe neighborhood, ideal for someone downsizing or retiring, must see. Extra nice. $475/mo. + dep., tenant pays all utilities or $595/mo. + dep., we pay all utilities. Taking applications now. 582-7224. 41xtfnb________________________APARTMENT FOR RENT:2 BR, 2.5 BA. Carpet & tile, stove, refrigerator, dishwasher. No pets. References required. 859-200-3592 41xtfnb________________________ STUDIO APARTMENT Small, nice for one person, near Berea College. Utilities included. No pets. $425/mo. + $400 dep. 859-302-5432. 41x1p ________________________ APARTMENT FOR RENT: 1 BR Effi ciency, near Berea College. Utilities included. No pets. $500/mo. + $450 dep. 859-302-5432. 41x1p

TOWNHOUSE FOR RENT:Nice, 2 BR, 2.5 BA, laundry room, appl., privacy deck. $525/mo. + dep. & ref. 986-2525 or 979-5999 41x1b

HOUSE FOR RENT: Nice, 3 bed, 2 BA, brick house 110 Christmas Ridge $725.; Lg. 2 bed, 1.5 BA townhouse, 100-2 Morning View. $575.; All units have central heat & air. 986-2266. 12xtfnb________________________HOUSE FOR RENT: 3 BR, 2 BA. 1800 sq. ft. ranch. Appliances furnished. No pets. $950/mo. Ref req. 859-986-3389. 37xtfnb________________________HOUSE FOR RENT: Nice 3 BR, 2.5 BA, 3 car garage. $1000/mo. + $1000 dep. 859-358-0201 40xtfnb ________________________BRICK HOUSE FOR RENT: 3 BR, 2 BA, full basement, screened- in porch $1000/mo. + $1000 dep. 859-358-0201 40xtfnb

SPACE FOR RENT: 2200 sq. ft +/- with individual heat pump and electric meter, serving bar with hot and cold water sink and a bathroom. Room space for meetings and/or for storage. Asking $250 a mo. Call 859 200-5610. Ask for Jake. 34xtfnb

COMMERCIAL SPACE: 3000 sq ft. warehouse w/ 2 overhead doors and offi ce space. Close to I-75. Call 859-661-2090. 39xtfnb

LEVI JEANS $29.99, Car-hartt Jeans $26.99- Napier Brothers, 35 Public Square, Lancaster, KY. 6xtfnb________________________WANTED TO BUY: Your Antiques and collectibles. Antique glassware, furniture, quilts, all types of military items, clocks, watches (working or not), coins, and paper money. All types of gold, silver scrap, cast iron banks, toys, lighters, crock jugs, cast iron skillets, marbles, pocket knives, fi shing items, Indian Arrowheads, and much, much more. Also buying partial estates. Over 25 years experience. Call: Clarence Reece at 606-531-0467 43xtfnb

HOSTESS NEEDED: Apply in person at Dinner Bell. 127 Plaza Dr. 40xtfnb ________________________DRIVERS: New Dedicated, Regional & OTR Openings! Excellent Pay, Benefi ts, Home-time! Paid Vaca, Holidays! 1yr CDL-A exp Call JST Today: 1-855-534-2792 40x2p________________________TRUCK DRIVERS WANTED Contact Jerry Knowles 859-625-8312 [email protected] 41x2p________________________CDL-A DRIVERS: Tank and Hazmat required. Home every week. Solo and Team. Sign on Bonus paid at orientation. www.randrtruck.com Call Today! 1-866-204-8006 41x2p

GARAGE/MOVING SALE: 1340 Diana Dr. Burnell Homestead Estates. Fri. & Sat. 9 a.m.-2 p.m. Housewares, Christmas decorations, sewing & hobbies. Rain or Shine.

PLAZA DRIVESTORAGE

10x10 $35/mo • 10x20 $60/mo 10x40 $120/mo • 20x40 $180/mo

call/txt 200-7691, 582-4173


• APARTMENTS •





[email protected]





661-3259, 661-2306986-7692, 986-4095


____________________

Blakewood Storage

Units for Rent661-3259, 661-2306986-7692, 986-4095

Subscribe to the Berea CitizenTODAY!

Have the paper delivered right to your mailbox

for only $26 in Madison County; $35 elsewhere.

(859) 986-0959

• SERVICES •



• EMPLOYMENT •



Lancaster, KY





986-5644










Autumn Ridge







(859) 986-8894 or (859) 661-0036 (nights)





Call (859) 985-7077


for sale. $50,000.859-986-4095

RENTED




House for Lease




• LOT •

WILESTrailer Park

SPACE FOR RENT

859 661-3259 859 986-4095


859 661-0036

APTS & • APARTMENTS •











• COMMERCIAL •

Call (859) 661-0304 or (859) 625-2528





Davis$20 - $60859-582-9710Hwy. 21 West

115 Linda Ln.

Storage Units• YARD SALE •

BRTODD INVESTMENTS


utilities included

2 BR Apartments

(859) 661-2950

• COMMERCIAL •




$500 dep. 1 year lease. Call (859) 625-2760 after 3 p.m..



HEATING & COOLINGRepair and Replacement

SILVER CREEK Iis now accepting applications

for individuals & families. Immediate openings.

2 BR, Rent starts at $445

(859) 986-7765TDD: (800) 648-6056



REALTY WORLD®

TM





Berea & Richmond


ONE OF OUR AGENTS!

Kim GipsonRealtor

859-200-1864


859-623-1900


859-623-1900



859-779-9935

Paul HobbsRealtor

859-979-3040

Jason WilsonRealtor

859-358-3016



859-625-2066


859-358-6083


Paula MooreRealtor

859-358-4481

Donna MabesRealtor

859-868-8847

Kenny HowellRealtor

859-979-0462


859-302-2762

Nathan HackRealtor

859-351-9303

•199MorningviewRd.$119,900MLS#54222






•51FirstSt.$139,900MLS#53743

















•116St.Anne’sCt.MadCo.NW$385,000

MLS#53162•112GladesSt.Berea$92,500MLS#53054










OPEN HOUSES SUN 2-43064

Sandersville Rd.Fayette Co.$293,000

MLS#54230Host:

Jason Wilson

524 Park Ridge Dr.

Richmond$327,900

MLS#54134Host:

Jason Wilson


The Berea Citizen is placed in

conformity to equal housing rules.

Nelson Tree Servicewill be conducting a job fair to hire experienced

Forepersons and Trimmers It will be held on

Tuesday, March 29 at 6pmat Comfort Inn & Suites

located at 1918 W. Hwy 192, London, KYMust pass drug screen. Check us out at www.nelsontree.com. EOE-AA: M/F/V/D Safety and Professionalism... It’s the Basics!


Witnessing a break in?With the holidays approaching, break ins are occuring more often.

Make sure you lock your cars and homes!

Call Central DispaCh for immeDiate poliCe response

623-1248 or 623-1269

Don’t let your home be burglarized

• Make your home look occupied all the time. Use automatically timed

lights and radios. Don’t allow phone ringers to be heard outside and never leave notes on your door.

• Make sure there is good lighting outside of your residence.

• Install motion detector lights.• Always lock your doors, and do

not hide a spare key outside.• Do not post your vacation times or whereabouts on

social media outlets.

Rockcastle Regional Hospital and Respiratory Care Center in Mt. Vernon is currently seeking:

REGISTERED NURSES (RN)LICENSED PRACTICAL NURSES (LPN)

for Acute Care, Long-term Care, Special Care Units and Emergency Department (RN). Full-time, Part-time, and PRN positions available.

Apply on-line at rockcastleregional.org/careers

You became a nurse to care for others!

Big things are happening for our community at Rockcastle Regional. Be part of the team that is making a

difference in the lives of our patients.


Berea Board of Education # 3 Pirate Parkway, Berea, KY 40403 (859) 986-8446 Fax (859) 986-1839

www.berea.kyschools.us

The Berea Board of Education will be receiving bids for banking services for the 2016-2018 school years per Board Policy 04.2.

All bids must be received by 2:00pm on April 13, 2016.

All local banking institutions are invited to attend a pre-bid meeting on Thursday, March 24, 2016 at 2:00pm at the Board of Education office to discuss the bid documents and process for banking services. A repre-sentative from your banking institution may attend this meeting. The necessary bid forms may be picked up at that time. If there is not a representative available to attend, the documents will be mailed upon request.

Please contact Debbie Holbrook, Treasurer, at 859-986-8446 with any questions.





859-986-84011-800-998-2063 • fax 986-6173

FosterRealtors®


320 PINE STREET PENDING $129,500 MLS#53192 Phil Malicote 582-8882 114/116 BAUGH ST. PENDING $79,900 MLS#52567 Phil Malicote 582-8882 119 LYNNE DR. New Construction 3 BR, 2 BA $196,900 MLS#53171 Phil Malicote 582-8882 138 LORRAINE COURT (Duplex) $92,500 MLS#53010 Phil Malicote 582-8882633 KING LUKE CT. (Kings Trace) 5 BR, 3.5 BA 1 acre $229,900 MLS#51812 Janet Bowman 302-3123645 WOODSIDE WALK (Condo) 2 bdrms, 2 bths $116,000 MLS#51922 Connie Lawson: 661-0285BOX 451 RT. PENDING MLS#51191 Janet Bowman: 302-3123 914 BIG HILL Rd Mt. Vernon 4 BR, 2 BA, fenced back yard 1 1/2 acre $75,000 MLS#50950 Janet Bowman 302-3123 79 CENTRAL AVE. 2 bdrm, 1 bth $59,000 MLS#50551 Phil Malicote 582-8882



DETAILS! 859/986-8401


5115 WALNUT MEADOW RD. 1 1/2 Story, 5 BR, 3 1/2 BA, 1 acre lot. Finished 2nd Floor with plenty of room for 2 additional bedrooms if needed $269,000 MLS#54184 Phil Malicote: 582-8882 208 PEACHBLOOM HILL PENDING $138,500 MLS#54061 Phil Malicote: 582-8882 616 C. VALLEY DRIVE 3 BR, 3 1/2 BA Log Home 40 acres $325,000 MLS#53952 Janet Bowman: 302-3123 182 E. HAITI RD. 3 BR, 2 BA, Basement style apartment. A must see. $99,900 MLS#53922 Lisa Foster: 582-1010 1050 FREEDOM SCHOOL RD. Mount Vernon 3 BR, 2 BA Doublewide on 1/2 acre lot. $59,000 MLS#53836 Don Foster: 582-1100 212 ADAMS STREET 2 BR, 1 BA Located in Artist Area Old Town Berea. Garage/Workshop $59,000 MLS#53767 Sune Frederiksen: 248-0690 1019 HONEYSUCKLE COURT 3 BR, 2 BA, 1 Acre $125,000 MLS#53735 Phil Malicote: 582-8882 726/728 O’POSSUM KINGDOM ROAD 2 BR (possible 3rd), 1 BA Recently remodeled 2.5 acres with barn, storage shed. Includes a 1,936 sq. ft. commercial bldg. currently being used as body shop with ef-ficiency apartment. $179,900 MLS#53707 Phil Malicote: 582-8882 120 N. BROADWAY STREET Historic City Jail & extra lot. Totally Updated. Great for Retail or Office. $155,000 MLS#53663 Phil Malicote: 582-8882 110 PARSONS LANE (Mt. Vernon) PENDING MLS#53505 Janet Bowman 302-3123 126 MEADOWLARK DR. 3 BR, 1 BA, $81,900 MLS#53408 Candi Vester 224-6550, Amanda Hill 661-0460140 TREMONT DR. 4 BR, 3 BA full finished walkout basement 2 kitchens 1 acre $229,000 MLS#53250 K Fain 582-6502

106 EXETER AVE. $27,500 Middlesboro Janet Bowman 302-3123294 DOGWOOD DR. - 0.49 Comm. Lot $100,000 MLS#52820 Candi & Amanda 224-6550 or 661-04601 PAINT LICK RD. - 6.13 Comm. Land. $1,500,000 MLS#53821 Candi & Amanda 224-6550 or 661-04601 DOGWOOD DR. - 8.51 Comm. Land $2,100,000 MLS#53822 Candi & Amanda 224-6550 or 661-0460FARM/ 2325 PEGGY FLATS RD. 182.56 acres prime farm land located 2.3 mi. from I-75. Completely fenced, 3 ponds, gently rolling. $912,500 MLS#53761 Phil Malicote: 582-8882 FARM/ 405 LOCUST BRANCH ROAD 543 acre farm, 200 year updated log home, plus modern 6 year old home. 3 barns, 2 machine sheds. Stocked pond. Guest cottage $1,200,000 MLS#53543 Phil Malicote 582-8882FARM/ 1775 GUYNN RD. 120.55 acres located within 3 mi. of I-75 & Berea.Barns, ponds, pasture, tillable land, woods & wildlife $350,000 MLS#53401 Phil Malicote 582-8882 BREEZY HOLLOW RD. 7.98 acres cleared land. Several bldg sites. $32,000 MLS#53517 Phil Malicote 582-8882 412 RICHMOND RD. - SOLD $49,900. MLS#48778. Phil Malicote 582-8882.

928 W. Jefferson St.(3) Office/Retail Buildings on 2+ acres in city limits of Berea.

920 Jefferson is 2 story w/approx. 3,836 sq.ft., 926 W. Jefferson is 1 story w/approx 2,622 sq.ft. 928 W. Jefferson is 2 story w/approx 3,888 sq.ft. 12X20 detached garage. 36+

parking spaces

$537,600 MLS#54289Phil Malicote 582-8882

126 Meadowlark Dr.Reduced to$81,900

MLS#53408Hostess:

Amanda Hill661-0460

217 Trillium Loop (Twin Lakes Subd.)

$229,900$5,000 towards

Buyer’s Closing Costs.

Host: Paul Blackburn 544-0101

NEWLISTING

OPEN HOUSESSun. Mar. 20

2-4 pm




(859) 986-9417home

(859) 302-8411mobile


(859) 986-9797



LAND

• 3006 NoblE CT. | wACo ............................................................................... $390,000• 104 wooDS TRAIl | RIChMoND (DUPlEX) ........................REDUCED $159,900• 137 CRoSSING VIEw DR. ............................................................... SOLD $119,900• 911 GREENwooD DR... ......................................................................SOLD $169,900• 124 CENTRAl AVE. (DUPlEX) ......................................................... SOLD $89,900• 128 CENTRAl AVE. (DUPlEX) ......................................................... SOLD $89,900• 262 ShoRT lINE Pk. (15.25 ACRES) .......................................REDUCED $160,000• 270 wIllIAMS ST. (MT. VERNoN CoMMERCIAl) .......... REDUCED $69,900• 211 GlADES ST. ....................................................................................SOLD $121,900• 446 ChRISTMAS RIDGE RD. .............................................................SOLD $125,000• 420 PlUMTREE DR. (NEw ShINGlES) ...................................................... $127,900• 2800 RIChMoND ST. (RENFRo VAllEY) 1A. ......................REDUCED $119,000• 2780 RIChMoND ST. (RENFRo VAllEY) ............................. REDUCED $70,000

Hosted by:Kim Claytor

(859) 661-3772&

Colette Ingram(859) 302-2003

OPEN HOUSE SUNDAY 2-4 p.m.

Beautiful mountain views from this 3 BR, 2 BA all brick home on over 3 acres! Large front porch, partially wooded lot, large upstairs room, washer & dryer convey.$155,000

710 Red Lick Road

KCEP is looking for a highly motivated individual to join its team as a summer research intern. Visit www.kypolicy.org for details. EOE.

MADISON COUNTY HEALTH DEPARTMENTTo protect, promote and improve the health of our community.

216 BOGGS LANE • PO BOX 1208 • RICHMOND, KY 40476-1208(859) 626-4241 • (859) 623-5910 FAX

The Madison County Health Department is accepting applications for the following positions:

• SeniorSupportServicesAssociateI-FullTimePosition. StartingSalary:$10.10-$12.41/hr.,negotiablewithadditionalexperience.Grade10.

• AdministrativeSecretary–Environmental–FullTimePosition. StartingSalary:$10.70-$13.14/hr.,negotiablewithadditionalexperience.Grade13.

• HealthEducatorI–HANDS–FullTimePosition. StartingSalary:$12.15-$14.92/hr.,negotiablewithadditionalexperience.Grade15.

Applications and full listing of qualifications may be obtained at the Madison County Health Department, 214/216 Boggs Lane, Richmond, KY or at the Martha Pride Community Health Center, 1001 Ace Drive, Berea, KY OR online at www.madisoncountyhealthdept.org

Completed applications must be received at the Madison County Health Department, P.O. Box 1208, Richmond KY 40476-1208 by close of business on Friday,April1,2016.

Resume will not substitute for completed application.


Applicants and employees in this classification may be required to submit to a drug screening test and background check.





ALSO AVAILABLE...








ABSOLUTE ONLINE ESTATE

AUCTIONEER: SAM FORD www.fordbrothersinc.com

Somerset, KY Mt. Vernon, KY London, KY 606-679-2212 606-256-4545 606-878-7111

800-435-5454


In order to settle the estate of the late Geneva Botkin, her daughters, Ms. Becky Duerson & Ms. Marieta Eaton, have authorized our firm to sell all of her personal property at absolute high dollar.

Items available include:Pennsylvania House Cherry hutch ~ Pennsylvania House Cherry table & chairs ~ Cherry tea cart serving tray ~ loveseats ~ couches ~ coffee & end tables ~ recliners ~ living room chairs ~ dry sink/server ~ 3 piece Cherry bedroom suite ~ 4 piece Maple bedroom suite ~ Crosley stereo ~ Voice of Music stereo ~ bedroom sets ~ bakers rack ~ woven baskets ~ desks ~ mirrors ~ vases ~ numerous lamps ~ framed prints ~ wall hangings ~ microwave ~ Bybee dishes ~ pressure cookers ~ candlesticks ~ linens ~ towels ~ plant stands ~ Quasar T.V. ~ bar stools ~ various glassware ~ picnic table ~ decorative plates ~ China sets ~ and much, much more!

This is only a partial list of what will be offered online. We encourage you to log on to www.fordbrothersinc.com to view a full list of items with pictures.PREVIEW DATES: Friday, March 25th & Thursday, March 31st from 3-6 p.m. at 119 Holly Hill Dr. in Berea.PICKUP DATE: Friday, April 1st from 1-6 p.m. at 119 Holly Hill Dr. in Berea.

BUYER’S PREMIUM: A 10% Buyer’s Premium will added to the winning bid to determine the final sales price.TERMS: Payment in full due at time of pickup, in the form of cash, check, MasterCard or Visa with an additional processing fee.

Announcements made day of sale take precedence over printed material.

of The Late Geneva Botkin’sPersonal Property, Antiques & Glassware

Bid Online Now!Sale Ends Thursday, March 31, 2016 at 6 p.m.


(859) 986-0373




859 200-2090

FOR SALE


New Kitchen in 2014


859.625.4824

Suncrest Meadows



PRICEREDUCED!

ORDINANCE# 06 - 2016

AN ORDINANCE OF THE CITY OF BEREA, KENTUCKY, AMENDING THE 2015-2016 FISCAL YEAR BUDGET FOR THE CITY OF BEREA, ORDINANCE # 06 - 15REVENUES AND EXPENDITURES.

The City Council ofthe City of Berea, Kentucky, does ordain as follows:

SECTION I

That Ordinance# 06 -15, Fiscal Year 2015-2016 Annual Budget, be and the same is hereby amended so that the amended fund revenue, fund expenditures, and ending fund balances for each fund shall be as follows:

BEGINNING FUND $10,204,660 $10,901,547BALANCESRevenues: 2015-16 2015-16 BUDGET BUDGET AMENDEDMunicipal taxation $3,032,411 $3,020,178License and permits 6,130,200 6,295,200Charges for services 333 ,900 330,800Fines and forfeitures 44,800 48,300Intergovernmental revenues 1,324,250 1,221,250Investment income 22,570 22,570Other Financing Sources 11,137,816 11,137,816TOTAL CITY REVENUES 22,025,947 22,076,114

TOTAL FUNDS AVAILABLE 32,230,607 32,977,661

Expenditures: City 2015-16 2015-16 BUDGET BUDGET AMENDEDPersonnel $6,746,131 $6,799,052Utility services 492,595 500,545Materials & Supplies 961,200 894,100Service & Support 2,452,521 2,473,821Other Expenditures 1,281,050 1,296,281Capital Outlay 14,016,000 13,992,400Debt Service 366,136 361,647TOTAL CITY $26,315,633 $26,317,846EXPENDITURES

ENDING FUNDBALANCE JUNE 30,2014 $5,914,974 $6,659,815

PROPRIETARY FUNDSRevenues: UtilitiesTOTAL UTILITIESREVENUE $19,693,675 $20,193,675

Expenditures: UtilitiesPersonnel $2,253,425 $2,253,425Utility Services 541,600 542,350Materials & Supplies 374,500 374,500Service & Support 11,394,100 11,514,100Other Expenditures 3,758,752 4,043,752,TOTAL UTILITIES $18,322,377 $18,728,127EXPENDITURES

CHANGE IN NET ASSETS $2,947,806 $2,716,381

Other Expenditures Not Included in Change in Net Assets:

Debt Service Principal 1,565,904 1,565,904Capital Additions 5,405,000 5,855,000TOTAL OTHER $6,970,904 $7,420,904EXPENDITURES

SECTION IIEach of the amendments made in Section I are hereby determined to be for a public purpose and in the interest and for the benefit of the City of Berea and its citizens.

SECTION IIIOther than specified in Section I above, the provisions of Ordinance No. __ -15 as amended, remain in full force and effect.

SECTION IVAll ordinances or parts of ordinances in conflict with this ordinance are hereby repealed.This ordinance shall be published according to law.

FIRST READING: March 1 , 2016.

SECOND READING AND ENACTMENT: March 15, 2016.

ATTEST: APPROVED BY:Cheryl Chasteen Steven Connelly, MayorClerk of the City Council

APPROVED AS TO FORM:Jerry W. GilbertCorporation Counsel

ABSOLUTE




ABSOLUTE




Saturday, March 19, 2016 at 10:30 am2008 Cherokee Trail, Richmond, KY

For an appointment to view this property or additional information,

please contact our auctioneer or log onto www.fordbrothersinc.com.

Charles Bowman & Paula Bowman’s 10 ACRES, BRICK HOUSE, BARN & PERSONAL PROPERTY



859-792-4025

SEVEN SPRINGS Landscaping & Lawn Care

• Free Estimates

• Over 20 years experience

(859) 661-1005


• Free Estimates


(859) 661-1005


Date: Saturday April 9, 2016

Time: 09:00 am Start Time

Checkin & On Site Registration

08:00—08:45

Location: Berea Municipal Utilities Parking Lot

200 Harrison Road

Berea, Kentucky 40403

BPD FOOT PURSUIT 10K RUN & 5K FUN WALK

Information

Benefiting Concerns for Police Survivors Kentucky Chapter

Early Registration Fee: $25 (Pre-registration Deadline April 8, 2015 by 5:00 PM)

Registration Fee day of Race: $30 Non—Refundable

For more information please visit ; https://runsignup.com/Race/KY/Berea/BPDFootPursuit10KRun5KWalk

2016 BPD Foot Pursuit 10 Run & 5K Fun Walk

Registration Form

Name:____________________________ Email Ad-dress:______________________________

Address:___________________________ City:__________________ State:_______

Zip Code:______________

Circle T-Shirt Size: S M L XL 2X

Additional Shirt: S M L XL 2X ($10 each) $ 3 additional for 2X

Please Check on in each column;

___ 10K ____ Male ____ Age at time of Event

___ 5K ____ Female Release and Waiver of Liability

I, ____________________________ do hereby agree to indemnify, save and hold harmless, the City of Berea, Berea Police Department, or any other City Employee, or any of their agents or representatives for my health, safety, or injury resulting in my participation in any of the fitness programs. In addition, I understand that I shall assume full responsibility and liability for my actions during my participation with the City of Berea events.

Date: ___________________

Make all Checks payable to: City of Berea

Return Form to Berea Police Department @ 635 Chestnut Street.

Or Mail to: Berea Police Department 212 Chestnut Street Berea, Kentucky 40403

rials for the experiments. So far the class has raised $2,330, which is enough for the launch, but they are hoping to raise more so they can pur-chase extra materials for the experiments. And perhaps even t-shirts for the class.

As long as they have good weather conditions, the stu-dents are planning to launch the weather balloon on Sat-urday, April 16. Most of them will travel north of Bard-stown for the actual launch, while a few others will stay in Berea for the “landing.” The balloon will stay in space for a couple of hours, and when it reaches approximately 100,000 feet up, it will pop and come back down.

They are launching north of Bardstown, Woodward said, because of the wind patterns in this area, which will push the balloon towards Berea.

Members of the Launch Committee in the science class will help to make the de-cision of whether the weather conditions are appropriate for the launch. Oth-er committees in the Honors In-tegrated Science Class include A d m i n i s t r a -tive, Executive, Media, Design/Construct ion , Testing, and Re-search.

The students admitted that working on the committees was the hardest part of the project.

“It’s the most challenging, but also the most rewarding,” one 9th grader said. “You have to push yourself.”

Several of the students have been working on the experiments that will be sent up with the bal-loon, while oth-ers have been calculating how much weight can be carried. There will be a GPS on the launch, but at some point that will quit working. At that point, students can track the balloon through a radio transmit-ter.

Plants and possibly tardi-grades -- seg-mented micro-animals -- will be sent up so students can see what affects the extreme condi-tions of space will have on them. Some of the students are still researching what will go in their “payload.”

“It was impor-tant to me that the students re-ally sunk their teeth into collab-orative work,” Woodard said. “To be honest, I really didn’t think this would work; I thought they would fail and we could learn from that. But they’re re-ally pulling this off.”

People who would like to donate to this project can go to www.gofund-me.com/pira-tesinspace.

LAUNCHCONTINUED FROM PAGE A1

city property.“But at this point, in

terms of negotiating a contract for the use of city property,” Connelly said at the end of the council meeting, “there will not be any Confederate flag em-blems given away or sold on city property intention-ally authorized by the city. That’s the position I’m going to take; everything else can be worked out.”

He said there would be exclusions worked into the agreements, so ex-ceptions can be made for groups such as the Battle of Richmond Association (BORA).

Meta Mendel-Reyes of BURJ, a group that formed in August 2015, first stood up at the council meeting to, “encourage or require that the Chamber of Com-

merce sign the contract that has been prepared by the mayor. We’re con-cerned about the Confed-erate flag merchandise . . . this is not a free speech issue, this is an issue of where my tax dollars go. We’re talking about a fes-tival that the City of Berea gives $5,000 to and prob-ably up to $15,000 in in-kind services.”

Mendel-Reyes said that people could “wear Con-federate flags on their shirts, on their heads,” but free speech didn’t extend to requiring a city-sup-ported event to sell Con-federate merchandise.

Napier addressed the council on behalf of the Berea Chamber, and ex-pressed regret that the request to not sell Confed-erate merchandise got all the attention by the me-dia. She stated that many of the additions to the contract – such as electri-cal concerns and limiting the number of booths –

were not fair to ask of the Chamber.

“What we are asking for is just the city’s support,” Napier said. “Let the 20th anniversary of the Spoon-bread Festival continue in its present location where it’s always been.”

Council member Jerry Little asked if chamber memebrs had looked at the second draft of the city contract that Connelly just sent, but Napier said they hadn’t had time to look at it carefully, but it didn’t look significantly different from the first one.

When council member Diane Kerby asked Napier what she was specifically asking for, Napier replied that they questioned why the contract had changed from previous years.

Conflicting views arose between Napier and Con-nelly about different inter-actions they had. Codes Director Dale VanWinkle also took issue with Napi-er’s assertion that he had

given his approval of their electric schematics.

“I won’t be lied on,” VanWinkle said.

Napier also asserted that Connelly had not met with them when a meeting was scheduled between the chamber and city, to which Connelly re-plied that he had not been invited.

“Let’s get to the table so we can talk about this,” Connelly said at one point, and Napier replied that, “You forget, sir, that we are run by volunteers and a board of directors that are all volunteers.”

“You’ll just have to over-come that,” Connelly said, who said he had been try-ing to meet with Chamber staff since November.

Sandy Rowlette stood up as well, to relay the history of the Spoonbread Festival, and she report-ed how many hours she and her family worked at the festival. She received a strong response from

some council members, however, when she said, “how many times has a council member partici-pated in the preparation of the festivals, or even cared to come down.’

“Whoa, whoa, whoa. We’re getting on a person-al level,” Kerby replied.

Gail Bowman from Berea College also ad-dressed the council, and said she has never known an African-American who was not offended by the Confederate flag.

Council member Steve Caudill informed audi-ence members during his comments that the city council had no power to affect the decision to re-strict the sale of Confed-erate merchandise on city property, since that power lay with the mayor.

Connelly scheduled a meeting with Napier and the Chamber for Wednes-day at 4 p.m.

CONFLICTCONTINUED FROM PAGE A1

A10 The Berea Citizen Thursday, March 17, 2016

Good Friday ServiceMarch 25th 7pm Join us as we remember

the Lord Jesus as he paid in full man’s sin debt.

Guest speakers, William Dooley, Bro. Ken Felty ofLiberty Avenue Baptist Church

Special Singing

Join us Back at Bethel for the annual

“Through a tree we were made debtors to God; so through a tree we have our debt canceled.”

— Irenaeus

Bethel Baptist Church

Pastor, Kenny Davis Jr.

859 986-7341Sharing an unchanging Christ with an ever changing world.

Hebrews 13:8 Jesus Christ , the same yesterday, today and forever.

Easter Egg Hunt and Children’s Easter Celebration

Saturday, March 26th 2pmSaturday, March 26th 2pm

Brushy Fork Park

Sunday, April 3rd 11:00 am serviceSunday, April 3rd 11:00 am serviceDinner to follow @ Silver Creek Cafeteria

Easter Sunday March 27 thSunrise Breakfast and Service 6:00 am

Resurrection celebration 11:00 amSpecial Testimony Service 7:00 pm

Homecoming Celebration

Memorial Hwy Berea

Pilot Knob Missionary Baptist ChurchPastor Greg Lakes

8091 Battlefield 859-985-9342

CELEBRATING 150 YEARS Join us for an early service at Pilot Knob Cemetery

on

Followed at 10:45AM by Easter Cantata and Service.

Easter Sunday, March 27th at 8:00AM followed by breakfast and fellowship in the church

fellowship hall.

Tolle building. They are the last four staff members still present in the city building on Chestnut, along with the firefighters. The fire de-partment, Stone said, will not be moving until they absolutely have to, since that move will affect the coverage area.

Stone announced that a private enterprise could be moving in the Wel-come Center train depot as of July, and they were currently finishing up the “old post office” so the county clerk could move over. By April 15, Stone said, the food bank would

be ready to move over to the old sewer commission building. It cost $70,000 to renovate the building for the Berea Food Bank.

In other business:• Bob Soffel from

CASA (Court Appointed Special Advocates) stated that the organization was in trouble, and they would need support from govern-ment entities if it was to survive. He passed out in-formation about Madison County CASA, and asked for support from the City of Berea. CASA volunteers act as a special advocate when a child is involved in family court.

• The amended budget for 2015-16 was approved, with Council member Ronnie Terrill as

the only negative vote. Ter-rill has voted against every budget of the City of Berea since taking office.

• City council ap-proved the new ordinance for alcohol licensing, which specifically defined what a stand-alone bar was in terms of eligible res-taurants.

• Two change or-ders were approved for the Berea Municipal Utilities. One change order was for a credit of approximately $35,000 for a sewer proj-ect, and the other was for an added cost of $10,500 for the new roof of the BMU building, where the contractors had to replace some metal.

CITYCONTINUED FROM PAGE A1

humanities written assess-ment.

For the written assess-ment at districts, up to three students from each school take a test with ap-proximately 35 questions. They have 35 minutes to complete the test. The top five students in each writ-ten assessment are invited to compete at Regionals.

It is the same for writ-ten composition, but these tests are on-demand writ-ing. Students are given a prompt to write about and will have 45 minutes to complete.

With future problem solving, four students from a school are on one team. That team is given a future scenario -- for about 30 years in the future -- and they use the six-step problem solving to try and figure out a solution. They are given 90 minutes

to complete. The top two schools from districts are invited to move on to Re-gionals.

For the quick recall com-petition, four students at a time from each school have a buzzer, and try to buzz in first with the cor-rect answer, somewhat like Jeopardy. There are two 10-minutes halves with a three-minute halftime. The top two schools from districts are invited to Re-gionals.

SJECONTINUED FROM PAGE A1

EDUCATION


King’s Eye Care






PLANS ACCEPTED

“What are your plans for Spring

Break?”

Javin Storm Hillard and Jeris Stone Hillard said, “We’re going to

spend time together in Berea.”

Gary Johnson said, “I plan to work all I can.”

By Randy Coffey/The Citizen


Like Us On


Eliana and Aiden Slemp said, “We’re going to Georgia to visit close

friends.”

Meet London Horn, a 16-year-old tenth-grader at Madison Southern High School. His par-ents are Larry and Libby Horn.Wants to Study: Engi-neering or veteri-nary science.Favorite part of school: Band classHobbies: Riding horses and marching bandSchool Talent: I work really well with our hors-es. I can ride just about all of the horses we have.School Activities: Archery, marching band, FFAProudest Moment in school: Receiving an award for maintaining a 3.5 GPA. Role Models: My family. They aren’t perfect, but they help me in any way possible.What does school mean to you: School is an opportunity to learn and develop social skills.Favorites: Musician - Carrie Underwood, I love listening to her music; Movie - Anything Marvel. the Marvel movies always keep me entertained; school subject - history, if we learn about the past, we can predict the future; book - I read too many books to pick a favorite; place to vacation - Kansas, its open fields and open air; place to live - Berea, KY, there is no place like home.

Student of the Month



NEW CAR WASH

COMING SOON!


Service & Repair


Eight high school students from Berea Community, a male and female from each grade, have been working with the Madison County Chapter of Glean KY, to collect extra produce from the school’s breakfasts and lunches for low-resource families in the community. Above (l-r) Kijyane Santiago, Virginia Deaver, and Della Walters show the gleaning basket from the Berea Community cafeteria, with extra food collected from breakfast.


For senior Della Walters, organizing the gleaning program at Berea Com-munity School is about helping other students serve.

“It helps them under-stand how much we waste as a society, and offers them a way to give back that is accessible to all of them,” Della said.

The idea to collect and redistribute fresh pro-duce and non-perishable food came from Berea Community’s middle and high school principal, Donna Lovell, and a par-ent, Nancy Naumer, back in November. Eight high school students then got on board, a male and a female from each grade, and met with the Madison County Chapter of Glean KY. They decided to be a part of Glean KY’s work and do what they could at the school.

The next step was to raise awareness among the other students. After a fun round of mock prac-tice with the other leaders, the teams made presenta-

tions to the elementary classrooms.

This past week was the first one with a consistent schedule of collecting.

The volunteers take turns monitoring the bas-ket for the correct items, and weighing the food after each meal. They are gathering between five and seven pounds of food a day.

Walters noted that many students have come on board with the idea. When bananas were served for a meal without the collec-tion basket out, several students put their fruit on the table anyway.

“This program puts healthier food in the hands of people who might not be able to afford it,” Wal-ters said.

Currently, the Glean volunteers are offering the food to any student who needs it through the Fam-ily Resource/ Youth Ser-vices Center at the school. The original idea was to offer it through the week-end backpack program, but the logistics were diffi-cult to work out. Once the Glean volunteers gather more than students can

use at the school, the extra will be offered to the Food Bank.

This student-led initia-tive is filling two needs –

both reducing the amount of food waste, and pro-viding more healthy food to students. In that way, Berea Community is suc-

ceeding in its mission to “…educate each student to be a fulfilled, respon-sible citizen.”

Berea Community Students Help to “Glean” Food for Students in Need

Nevin Myers from Berea Community won 4th place in science at the Regional Academic Awards this past Satur-day, which took place at Farristown.

The fourth-grader was the only elemen-tary student from Berea Community to place at Regionals.

Myers Places at Academic Team

Regionals

Academic Accomplishments of Berea’s College Students

Berea college students were recognized for aca-demic achievement as well as completion of a bachelor’s degree at both Berea College and EKU.

Jennifer Walden, Han-nah Williams Beaver, Jordan Bentley, Court-ney Byrd, Jay Callahan, Anna Taylor, Amber Cash, Sarah Chapman, Anna Soares, Jonathan Smith, Aaron Ponder, Willa Richardson, Ying-tai Feng, Emily Ross, Ga-briel Gomez, Ryan Rut-ter, Ricky Green, Malcom Johnson, Haley Hobson, Soncera Keene, Chelsey Lyons, Ifeanyi Madu-jibeya, James Mullins, Rustina Mullins, Ahmad Najwa, and Thomas Ow-ens were all named to the Fall 2015 Dean’s List at Berea College.

A student is named to the Dean’s List who achieves a GPA of 3.4 or higher for a minimum

course load equivalent to 16 semester hours.

Several Berea stu-dents received degrees from EKU at separate academic college com-mencement ceremonies from Dec. 11-12, 2015.

The graduates from Berea were Patricia Vaughn Alexander, Lau-ren Elizabeth Applegate, Angela G. Arnett, David John Barnes, Shane Ryan Brindley, Brandi Aman-da Burchfield, Gabri-elle N. Burgess-Abney, Zachary Ray Cantrell, Matthew Brandon Cole, Matthew Alan Colwell, Travis Lee Cox, Devan Austan Dannelly, Sandra H. Davis, Melinda De-Shong, Lauren Beverly Disney, Lauren Alyssa Dolen, Branden Dudley Everett Dyehouse, Jessi-ca Marie Flannery, Fred-erick Fowles, Emily Vic-toria Fox, Kyle F. French, Jamie Diane Hisel, Mar-

lene Holbrook, Zachary Wayne Holman, Mark Anthony Huguely, James Leroy Hunter, Robert S. Johnson, Charles Wayne Judd, Charles Wayne Judd, Brittany Danielle Kelly, Eric Douglas King, Katrina Clara Krauss, Brandy Laine Land, Amanda Kimberly Lew-is, Tamra Nicole Lutes, Jason O’Neil Mays, Lisa Lynn Moore, Mollie Eliz-abeth Moss, Craig Waco New, Charles Ralph O’Neal, Stephen Michael Reagin, Tiffany Carol Richard, Fred Rweru, Joel Matthias Sanderson, Brooklin Paige Sarver, Jennifer Michele Shelton, Elisha Adam Shepherd, DeDee DeLaine Rae Vanover, Sarah Elizabeth Williams, Zachary Rob-ert Williams, David Lee Willis, Sabrina Justrae Wilson, and Melissa Wy-att.




NEWSPAPER








Local News

SEE PROP, PAGE B6

M A R R I A G E S

February 23 Tracy Lynn Combs, 47,

Berea, self-employed, to James Denton Thompson, 54, Berea, retired

March 5Rosie Louise Wagers, 32,

Berea, day care, to Edward Lee Anthony Alexander, 36, Berea, janitor

Brianna Lynn Culton, 21, Richmond, homemaker, to Allen Otis Murphy, 23, Richmond, disability

March 9Jennifer Sue Tacket, 49,

Richmond, homemaker, to Larry Dale Johnson, 45, Richmond, self-employed

Marita Lynn Duffy, 27,

Richmond, stay-at-home mom, to Bradley Scott Lamb, 27, Richmond, stay-at-home dad

March 10Ui Yong Ito, 60, Rich-

mond, studio owner, to Yun Bae Park, 36, Rich-mond, salesman

March 4Kevin Ray Saylor vs.

Donna Lynn SaylorMarch 7Willa Blue Richardson

vs. Timothy Ryan Richard-son

March 8Bethany Nicole Phelps

vs. Tyler Andrew Phelps

Cabinet for Health and Family Services for Makala W. Hafer vs. Jacob R. Hafer

Cabinet for Health and Family Services for Debo-rah K. Puckett vs. Crystal D. Puckett

March 9Sasha Wilson vs. Derek

Wilson

Amber Lynch vs. Robert Lynch

Cabinet for Health and Family Services Ex Rel: Natasha M. Marcum vs. Timothy J. Marcum

March 10Chelsea Lynn Koch vs.

Kenneth Joshua Koch

Domestic and Family cases filed in Madison Co. Circuit Court between March 4, 2016 to March 11, 2016:



Madison County Detention CenterFrom March 5, 2016 to

Marcy 11, 2016

March 5Milan Miraz, 61, Rich-

mond, public alcohol in-toxication

Justin Moran, 20, Rich-mond, fourth degree as-sault – domestic violence, possession of marijuana, buy/possess drug para-phernalia

Roy Bromwell, 28, Rich-mond, probation violation

Jennifer Morgan, 49, Richmond, theft by unlaw-ful taking – shoplifting un-der $500

Shannon Matthews, 26, Waco, buy/possess drug paraphernalia, failure of non-owner operator to maintain required insur-ance, failure to register transfer of motor vehicle, operating on suspended or revoked operator license, first degree possession of controlled substance

Johnny Farthing, 35, Richmond, violation of conditions of release

Gerald Eaton, 43, Berea, failure to appear

Barbara Whitaker, 28, Richmond, failure to ap-pear

March 6Greg Farmer, 34, Rich-

mond, probation violationBenjamin Sweger, 30,

Lexington, operating mo-tor vehicle under the influ-ence of alcohol or drugs

Natasha Ormes, 31, Richmond, non payment of fines

Makayla Trimble, 19, Irvine, first degree pos-session of controlled sub-stance, possession of mari-juana, buy/possess drug paraphernalia, endanger-ing the welfare of a minor

Elvin Smith, 28, Rich-mond, first degree traf-ficking in controlled sub-stance, buy/possess drug

paraphernalia, possession of marijuana, endanger-ing the welfare of aminor, third degree possession of controlled substance

William Harrison, 50, Waco, failure to appear

Tarol Johnson, 28, Berea, public intoxication of con-trolled substance

Paul Lamb, 30, Rich-mond, falsely reporting an incident, second degree disorderly conduct

Everett Lamb, 59, Berea, failure to appear

Tony Calihan, 64, Rich-mond, contempt of court

Lorayne Dilley, 24, Rich-mond, fourth degree as-sault – domestic violence

Joshua Callahan, 27, Ir-vine, fourth degree assault – domestic violence, viola-tion of a Kentucky EPO/DVO

Brandon Marshall, 27, Richmond, serving bench warrant for court

Gregory Botkins, 49, Berea, fourth degree as-sault – domestic violence, third degree criminal tres-passing

Brittany Suttles, 25, Rich-mond, theft by unlawful taking – shoplifting under $500

Angela Agee, 27, Rich-mond, third degree crimi-nal trespassing

March 7Darrin Pulliam, 25, Rich-

mond, failure to appearErnest Wagers, 45, Rich-

mond, contempt of courtLola Baker, 44, Berea,

public intoxication of con-trolled substance

Johnny Vickery, 42, Lex-ington, contempt of court

Adlie Penman, 37, Rich-mond, hold for court

Curtis Sparks, 31, Berea, contempt of court, proba-tion violation, failure to appear

March 8Derrick McKinney, 30,

Richmond, parole viola-tion

Michael Whitt, 28, Berea, second degree burglary, third degree criminal mis-chief

Kevin Reen, 28, Park Hill, Okla., public alcohol intoxication

Anthony Lizer, 42, Rich-mond, public alcohol in-toxication

Stephanie Miller, 47, Richmond, probation vio-lation

Jessica Rogers, 31, Clay City, hold for court

Ondria Hickey, 38, Rich-mond, contempt of court

Kay Bullen, 25, Rich-mond, serving time

Angel Jackson, 29, Rich-mond, serving time

Brian Lacy, 43, Win-chester, parole violation

Kayla Whitaker, 23, Rich-mond, serving time

Daniel Petkus, 52, Rich-mond, public alcohol in-toxication, second degree disorderly conduct

Shawn Hearn, 43, Rich-mond, public alcohol in-toxication

Jennifer Hearn, 52, Rich-mond, public alcohol in-toxication, illegal posses-sion of legend drug

Thomas Broaddus, 54, Richmond, operating mo-tor vehicle under the influ-ence of alcohol or drugs

Becky Hasley, 29, Rich-mond, serving weekends

Thomas Miller, 59, Rich-mond, operating motor ve-hicle under the influence of alcohol or drugs

Elliot Dooley, 37, Berea, receiving stolen property under $10,000, persis-tent felony offender, four counts of failure to appear

Steven Johnson, 33, Ir-vine, public intoxication of controlled substance

Brian Hatcher, 32, Berea, failure to appear

Buddy Durham, 19,

Berea, possession of mari-juana, carrying a concealed weapon, one headlight

Tabitha Hatcher, 35, Berea, contempt of court

March 9Mitchell Wren, 41, Berea,

second degree wanton en-dangerment, third degree criminal mischief

Sadie Blevins, 52, Rich-mond, failure to appear

Tasha Jackson, 26, Rich-mond, operating motor ve-hicle under the influence of alcohol or drugs, license to be in possession, failure to wear seat belts

Trevor Griffith, 21, Rich-mond, public alcohol in-toxication

Kelly Tribble, 35, Rich-mond, probation violation

Lonnie Neal, 34, Rich-mond, parole violation, serving bench warrant for court, failure to appear

Dustin Ard, 32, Rich-mond, failure to appear

Phillip Watson, 33, Dan-ville, theft by unlawful tak-ing – firearm, two counts of theft by unlawful tak-ing – between $500 and $10,000, theft by deception – include cold checks un-der $500, failure to appear

Misty Daniel, 33, Rich-mond, serving parole vio-lation warrant

Frannie Noland, 41, Berea, failure to appear

Jerry McGee, 45, Rich-mond, second degree as-sault – domestic violence

Janelle Newman, 22, Richmond, carrying a con-cealed weapon, failure to appear

Erica Gabbard, 24, Rich-mond, contempt of court

Sarah Carter, 29, Rich-mond, theft by unlawful taking, first degree pos-session of controlled sub-stance – heroin, tampering with physical evidence

Vickie Evans, 52, Rich-mond, operating motor ve-

hicle under the influence of alcohol or drugs

Ashley Brown, 27, Rich-mond, fourth degree as-sault – domestic violence

March 10Cecelia Nunn, 42, Rich-

mond, contempt of courtOliver Adams, 37, Stan-

ton, hold for otherBrandon Embry, 28,

Berea, serving timeJoseph Campos, 23,

McKee, serving timeRandall Witt, 62, Sand

Gap, two counts of failure to appear

Courtney Ramsey, 34, Lexington, serving time

Derek Damrell, 33, Rich-mond, public intoxication of controlled substance

Jonathan Stolkey, 31, Richmond, violation of conditions of release

John Williams, 31, Lex-ington, serving time

Stephen Robinson, 25, Berea, violation of condi-tions of release

Alonzo Denny, 28, Berea, parole violation, contempt of court

Terry Harrison, 34, McK-ee, violation of conditions of release

James Terry, 54, Rich-mond, public alcohol in-toxication

Candi Wright, 31, Berea, violation of conditions of release

Robert Haynes, 34, Win-chester, failure to appear

Gary Neeley, 26, Lexing-ton, failure to appear

Troy Reed, 40, Berea, non payment of fines, failure to appear, contempt of court

March 11Aaron Wildt, 18, Er-

langer, public alcohol in-toxication, third degree criminal mischief

Charles Hyden, 30, Rich-mond, fugitive from anoth-er state – warrant required

Brandon Willoughby, 29, Lexington, operating

on suspended or revoked operator license, operat-ing motor vehicle under the influence of alcohol or drugs, failure of non-own-er operator to maintain required insurance, illegal possession of legend drug, receiving stolen property under $10,000

Kelly Isenbarg, 39, Rich-mond, first degree bail jumping, violation of con-ditions of release

Ashley Rayborn, 27, Stanford, failure to appear, first degree bail jumping

Kelly Basham, 37, Wilm-ore, probation violation

Brendan Castle, 19, Lex-ington, failure to appear, first degree robbery

Sarah Rust, 24, Rich-mond, theft by unlawful taking – shoplifting under $500

Kristopher Eldridge-Isaacs, 23, Mt. Vernon, non payment of fines

Chastity Smith, 41, Berea, theft by unlawful taking – shoplifting under $500, first degree possession of controlled substance, sec-ond degree possession of controlled substance, pre-scription of controlled sub-stance not in proper con-tainer

Daniel Petkus, 52, Rich-mond, public alcohol in-toxication

Joshua Slone, 20, Stan-ford, operating motor ve-hicle under the influence of alcohol or drugs, non payment of fines

Deborah Eberwein, 59, Waco, failure to appear

Wilgus Johnson, 35, Haz-ard, failure to appear

James Richardson, 28, Richmond, hold for court

Rodney Hendricks, 30, Richmond, first degree criminal possession of forged instrument

From March 4 to March 10, 2016

Steven McKinney, Jr., Crystal McKinney, Kathy R. McKinney to Jasper Short, Lisa Short, property in Kirksville, north side of Curtis Pike, $43,293.27

Jacqueline Kohl Hamil-ton, George Hamilton to Bluegrass Property Rentals LLC, 415 Turpin Drive in Richmond, $120,000

Gary Powell, Jr., Crystal Powell to Kaitlin P. Cain, Kevin D. Cain, property on Hwy 21 in south edge of Berea, $84,900

Janet Gail Eggum, Ja-net Gail Hamon, John D. Eggum to Kelli D. Hunt, Jonathan R. Hunt, prop-

erty on the waters of Buf-falo Branch of Tates Creek, $210,000

Brad Hylton, Amy Hyl-ton to Cory Clark, 625 Cot-tonwood Drive in Rich-mond, $85,000

Pauline C. Combs Trust, Carol Combs to Christiane D. Taylor, Unit 304, Wilm-ore Park Condominiums, $165,500

Woodall Realty Compa-ny LLC to Ketton S. Bowl-ing, 972 Cobble Drive in Richmond, $19,000

M & T Property Man-agement LLC to JHV Construction LLC, 1330 Boonesboro Road in Rich-mond, $300,000

Surinder K. Kad to Jake C. Ellifritz, Stephanie N.

Ellifritz, 433 Cypress Place in Richmond, $200,000

William R. Hall, Lois Hall to Michael Albright, Jamie Albright, 3005 Plant-ers Row Drive in Rich-mond, $260,000

G VanWinkle LLC to Kent Hetzell, Pamela Het-zell, property on easterly side of Broadway in Berea; lots 11 and 12 of Stan-ley Powell Subdivision, $38,000

Charla Dawn Young, executrix, Jonell Turner Estate, Jo Nell Biggerstaff Estate to Billie J. Enciu, Mircea Enciu, Lots 48 – 50 Norwood Subdivision in Richmond, $122,400

Frances Moore Williams, Frances Moore, Brian Wil-

liams to Leonard N. Hobbs, Pamela N. Hobbs, 2039 In-digo Drive, $228,000

Federal Home Loan Mortgage Corporation to David N. Cooke, 152 Mountain View Drive in Berea, $96,000

Gwen Clore Vice, execu-trix, Lillian R. Williams Estate, Margaret Williams Core, Margaret J. Williams to Wesley W. Williams, Dorothy S. Williams, 200 Ginger Drive in Berea, $115,000

Frank L. Franklin, Vic-toria Franklin to Jay Beauchene, 444 Avawam Drive in Richmond, $290,000

Jeff H. King, Cheryl M.

King to Gregory E. Swords, Charlotte Bender, Lot 13, Rose Trace Subdivision, $190,000

Willard Alexander to Bill Alexander, Frankie Alexander, Tract, Madison County, $3,000

Dorothy E. Johns Estate, Donna Kidd, executrix to Patricia Ann Lowery, prop-erty on West Main Street in Richmond; Lot 1 in Lucy S. Collings, $82,000

Rosena F. Allen to Earl W. Gordon, Vivian N. Gordon, 1025 Echo Val-ley Drive in Richmond, $170,000

Robert E. Barnthouse, Phyllis Barnthouse to Bo-gie Farms LLC, property

two miles from Paint Lick and on the southeast side of Richmond and the Lan-caster Turnpike, $923,340

Secretary of Housing and Urban Development, Washington D.C., acting by and through the Federal Housing Commissioner to George Hughes, 795 Jacks Creek Road in Richmond, $85,000

J. Todd Christian to Gordon Family Limited Partnership, Lot 6, Green-way Heights Subdivision, $129,900

Thomas E. Lane, Debo-rah S. Lane to James Rob-inson, Tract, Tates Creek Road, three miles west of


WOR

D S

EARCH


SUDOKU ANSW

ER:CROSSW

ORD ANSWER:

Answer: Rochelle Humes

Answer: Wolf Blitzer

Answer: Russell Howard

Answer: Chris Bosh

Answer: Ryan Lewis

March 20–26

Guesswho’s


I was born on March 21, 1989, in Portsmouth,

Hampshire, England. I am a member of The Saturdays.

Who am I?

I was born on March 22, 1948, in Augsburg,

Germany. I host The Situation Room. Who am I?

I was born on March 23, 1980, in Bristol, England. I appeared numerous times on Mock the Week. Who

am I?

I was born on March 24, 1984, in Dallas, TX. I was

the first basketball player to achieve 10,000 points for

Toronto. Who am I?

I was born on March 25, 1988, in Spokane, WA. I

co-recorded the album The Heist. Who am I?

ATTACHBEINGBRIDGESCONTRIBUTIONDANCEDEFINEDINNEREAGERELVESERRORS

FAVORFILMSFORCEFUMESGUARDHORSEISOLATEDKINGSLEARNLENDS

LOOSENLUNARLYINGMEANSMUSICOBEYSOUTDOORSRANGERARELYRATIO

REPRESENTATIVERINKSRIVALSAFERSCHOOLGIRLSSCORESEVERALSHARKSHEETSITTING

SLANTSOLVEDSPADESSTOODUSEFULVINESVISITVIVIDYOU’LL CROSSWORD PUZZLE

ACROSS

1. SHARP AND STIMULATING7. CATCHPHRASE14. PAVED AIRSTRIP15. AFRAID16. BACK17. FORESIGHT19. THE MOST FLEXIBLE21. QUEEN, MAYBE22. COIN OPENING23. BAGGY24. “BEETLE BAILEY” DOG25. “ABSOLUTELY!”26. SWITCH MATERIAL27. PIPE MATERIAL28. ___ BEAR29. BUST30. DIVINE33. MAKE SPORT OF34. DEPTH CHARGE TARGETS35. JAZZ PLAYER, FOR EXAMPLE36. RINSE, AS WITH A SOLVENT37. KIND OF ENGINEER38. BON ___ (WITTICISM)41. EASTER FLOWER

42. ASPECT43. MAKER OF HOLES44. “THE THREE FACES OF ___”45. GOOD-FELLOWSHIP47. VACILLATED49. SPEAKER AT A UNIVERSITY50. EARACHE51. AS A PRECAUTION52. UNITS OF FORCE53. GAWKS

DOWN

1. NOISY2. TO MOVE OR STIR3. EMCEES’ LINES4. CANDIED5. GO-___6. A DOWNWARD FOLD7. PUDDING INGREDIENT8. ALL OVER AGAIN9. “SILLY” BIRDS10. BRINGING UP THE REAR11. BANK OFFERING, FOR SHORT12. DENIAL13. LACKING TEETH

18. PUT AWAY20. CRUSH24. AN ABALONE26. BUTTER UP?27. DIAGONAL FACE OF CHISEL OR GEM28. RELATING TO SOIL29. DRIED LEAVES OF THE FOX-GLOVE30. SUPPLIED WITH ENERGY31. STATE OF BEING COMPLETELY FORGOTTEN32. RANDOM GAMBLING GAME33. HAVE SECOND THOUGHTS35. SUMMER INSECTS37. ENTERED (2 WDS.)38. BRICK-AND-______39. GOOD-FOR-NOTHING40. NOT HERES42. NORTH DAKOTA’S LARGEST CITY43. CENTER OF ACTIVITY45. AX OF STONE46. MAR, IN A WAY48. “HEE ___”


5 9 1 4 2 3 7 6 86 3 8 7 9 5 4 1 27 4 2 8 6 1 5 3 93 1 4 6 8 7 2 9 52 5 6 9 3 4 8 7 18 7 9 1 5 2 6 4 34 8 7 2 1 9 3 5 61 2 5 3 4 6 9 8 79 6 3 5 7 8 1 2 4

SUDOKU


AND INFORMATION

CALL

SHEILA JOHNSON

986-0959

CryptoQuiz

She was the first woman to win a Nobel Prize in Literature:

____________________________________

Answers: 1) West Virginia, 2) China, 3) The Good Earth, 4) Immigration, 5) Adoption, Pearl S. Buck

Each of the following cryptograms is a clue to the identity of a woman in history. Using the hints X=A and K=N, decipher the clues to name the woman.

D A J Y C U Z L U K U X______________________

P G U K X_________

Y G A L E E N A X Z Y G______________________

U B B U L Z X Y U E K___________________

X N E F Y U E K______________

3

2

4

5

1

Whiten Your Smile

Help a Child



Melissa Jones, DMD



2




5 9 1 4 3

6 5 1

4 9

3 1 6 9

6 8

7 2 4 3

4 5

2 3 7

5 8 1 2 4











®-NO BULL-


Come See the

































































































REPLACEMENT RENTALS


(859) 986-7712


(859) 986-7595


(859) 985-2596


(859) 985-7371





office (859) 986-1802








“Forget the former things; do not dwell on the past. See, I am doing a new thing! Now it springs up; do you not perceive it? I am making a way in the wilderness and

streams in the wasteland.” -- Isaiah 43:18-19

P-CAB

986-1111

Mom & G’sAutomatic Car WashThe Best Car Wash in BereaPrince Royal Drive, Berea

Springtime is Clean Car Time!It’s time to clean your car at

Boone Square Shopping Center

859-985-0747




“People demand freedom of speech as a compensation for the freedom of thought which

they seldom use.”

-- Soren Kierkegaard


(859) 985-5577



[email protected]



































• Al-Anon, 6 - 7 p.m., Union Church.• TOPS (Take Off Pounds Sensibly),

6:15 p.m., Berea Baptist Church. For details, call Carol at 859-575-0173.






• Fiscal Court, 9:30 a.m.• Berea Elementary School SBDM

Council, 3:30 p.m., elementary confer-ence room.















Regular meetings

Calendar of eventsMarch 17• Berea College convo -- Della Mae performing

Vibrant Sounds Honoring the Roots, 8 p.m., Phelps-Stokes Auditorium. The five versatile female in-strumentalists and vocalists draw from rootsy influences to create original music.


• Free afternoon movie, 3:30 p.m., Madison County Public Library in Berea. Showing Alvin and the Chipmunks, Rated G.



• Aerobics, 5:35 p.m., Russel Acton Folk Center. $3 per class, or 10 visit punch card for $25.

• Aqua Zumba, 9 a.m., Berea College Seabury Pool. Free, bring own towel.

March 18• Camera Club, 5 p.m., Madison County Public

Library in Berea. All shutterbugs welcome.• Libraraoke, 6:30 p.m., Madison County Public

Library in Berea. Fun of karaoke w/o hangover.• Performance of Jeff Richey Experience - local

rock band, 7 - 9:30 p.m., Berea Center for the Arts. Admission - $5. Tickets at the door.

• Game Night for all ages, 6 - 8 p.m., Russel Ac-ton Folk Center. Madison County Library to join for extra games. Children’s Champion program.

March 19• 25th Annual Authors Brunch & Silent Auction,

10 a.m. - 12:30 p.m., Boone Tavern. Featured au-thors - George Ella Lyon and Lucy Flood present-ing works of her late father, Charles Flood. Tickets - $25; call 859-623-5832 by March 17 to reserve.

• Pie Auction for the Kentuckians For The Com-monwealth (KFTC), 6 - 8 p.m., Union Church. Cost - $5 for adults; free for 12 and under, or if pie is brought. Call 859-358-9713 for more info.

• Berea Writers Circle, 1:30 p.m., Madison County Public Library in Berea. Local author Laura Frantz will offer tips on researching.


• Berea Welcome Center Carvers Demonstrate, 10:30 a.m. - 3:30 p.m., Kentucky Artisan Center.

March 20• Family Fun Walk, 2 - 4 p.m., Farristown Middle

School at the track. Madison Mile a part of Chil-dren’s Champion Month. Bring canned foods for local food bank. If rain, will be in the gym.

• History of Black Gospel Music program, 3 p.m., Farristown Baptist Church. Farris family will be fea-tured musicians and vocalists.

• Jefferson Davis: On Dark & Bloody Ground performance, 2:30 p.m., Mt. Zion Christian Church in Richmond. Featuring Kentucky Chautauqua pre-senter Kevin Hardesty. Call 624-0013.

• Chess Club, 1 p.m., Madison County Public Li-brary in Berea. All ages and skill levels welcome.

• Spring Concert of Berea College Black Music Ensemble, 3 - 5 p.m., Berea Baptist Church. Open to the public, no admission charge.

• Poems on Healing and Self-Metamorphosis, 2 p.m., Madison County Public Library in Berea. Jane Olmsted and Barbara Wade to read from their new poetry collections.


Library in Berea. For ages 6 - 14.• Aerobics, 5:35 p.m., Russel Acton Folk Center.

$3 per class, or 10 visit punch card for $25.• Madison County Dulcimer Group Session, 5:30

- 8 p.m., Intergenerational Center, behind Russel Acton Folk Center. No experience necessary. Join in the jam, 5:30 p.m. with beginners and 6:30 p.m. with intermediates.

March 22• Conversation Cafe featuring Tina Parker, 6

p.m., Berea Arts Council. Poet Parker will be read-ing from her just published work, Mother May I. Book will be available for purchase at the event.

• Diabetes Prevention Program Informational Session, 5 - 6 p.m., Madison County Health Depart-ment in Richmond. Program with trained Life Style Coaches to help you. Call 859-228-2044.

• Toddler Tuesday, 10 a.m., Russel Acton Folk Center. Adult must accompany toddler.

• Madison County Dulcimer Group Session, 1- 4 p.m., Intergenerational Center, behind Russel Ac-ton Folk Center. No experience necessary. Join in the jam, 1 - 2 p.m. with beginners and 2 - 4 p.m. with intermediates.

• Baby and Toddler Time, 10:30 a.m., Madison

County Public Library in Berea. For ages 0 - 2 1/2.• One-on-One Computer Help, 12 p.m., Madi-

son County Public Library in Berea. Classes to ad-dress questions and concerns about computers.

• Tuesday Night Book Group, 6:30 p.m., Madison County Public Library in Berea. Selection for March is The Knitting Circle by Ann Hood.

March 23• Lenten Lunch, 12 p.m., Berea United Method-

ist Church on Fee Street, in Parish House. Begins with special music. Speaker - Rev. Kent Gilbert.

• One-on-One Computer Help, 12 p.m., Madi-son County Public Library in Berea. Classes to ad-dress questions and concerns about computers.

• Business Essentials, 3:30 p.m., Madison Coun-ty Public Library in Berea. For people looking to start a new business, or expand an existing one.

• Crafternoon: D.I.Y. Ice Cream, 3:30 p.m., Madi-son County Public Library in Berea. Workshop to make ice cream.

• Basic Spanish for Adults, 6 p.m., Madison County Public Library in Berea. Hispanic Outreach Project (HOP) offering ten-week course.

• Owl Painting, 6 - 8 p.m., Kentucky Guild of Artists and Craftsmen. Local artist Jonathan Clark will instruct on making colorful owl painting. Cost - $30. Call 986-3192 to sign up.

March 24• Fit Club, 4 p.m., Berea Community School. Free

elementary age activities. • Aerobics, 5:35 p.m., Russel Acton Folk Center.

$3 per class, or 10 visit punch card for $25.• Jammin’ on the Porch, 7 - 9 p.m., Russel Acton

Folk Center. Bring instrument and join in the jam.• Story Time, 10:30 a.m., Madison County Public


• Free afternoon movie, 3:30 p.m., Madison County Public Library in Berea. Showing Mocking-jay part 2. Rated PG.


March 25• Teen Book Party, 3:20 p.m., Madison County

Public Library in Berea. Party based on graphic novels, with Man of Steel showing later.








8:00 a.m.- 4:30 p.m.

BIG ONCOMMITMENT

AutoFarmHome


Business






Perhaps I can help.




Sune FrederiksenREALTOR®

Foster, REALTORS711 Chestnut 40403859-248-0690 Cell859-986-8401 Office

[email protected] member of the franchise system of BHH Affiliates, LLC

127 Plaza Drive, Berea986-2777



Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



The Smith Group










save the dates




2016

8 & 9

Thursday, March 17, 2016Local News



Lion president Eldon Davidson presented certif-icates and label emblems at the March 1956 meet-ing to the active members who helped start the club

in Berea. Carl G. Ford was given the Master Key Award, which D. B. Settles presented. Howard Fol-ey won the Lion’s music scholarship.

Dolly Hamilton, Peggy A. McCollum and Su-zanne Lou Hile all gradu-ated from the Berea Col-lege School of Nursing in 1956.

Twelve members of the Lions Club were honored in March 1956 as “Charter Monarchs” and “Old Monarchs.” These active members helped start the club in Berea in 1946, ten years before this photo was published. From left to right, front row, are Lester Britton, Dan Lengfellner, Otto Bowling, Dempsie Hart, and George Moore, Jr.; back row are Melvin Eplee, William Botkin, John Bill Allen, Bernard Davidson, Glyndon Miracle, and Hollis Sheats. Gilbert Jennings was not present.


David Fligor DISCOUNTPHARMACY

WelcomeDAVID












FAMILY MEDICINE










Napier, APRN


Richmond, $10,000Jade Commercial Servic-

es LLC to Tammy L. Torres, Joe L. Torres, 317 Elmsleigh Drive in Berea, $200,000

U S Bank National As-sociation to Brian Gordon, 3999 New Irvine Road in Waco, $35,000

Cheryl Lynn Duarte, Robert David Draeger to Kenneth Noble Powell, Marlena Dawn Powell, Lot 47, Walnut Grove Subdi-vision on Simpson Lane, $26,000

David S. Hensley, Misty D. Hensley to Randall J. Heffern, Lot 10, Deacon Hills Subdivision, $184,000

Wilson Associates Inc. to WW Investments LLC, Lot 11 Roselawn Subdivi-sion, located on Van Hook Court in Berea, agreement between the parties

Sowers Land LLC to Jo-seph B. Duff, Leisa N. Duff, 1.65 acres on Lancaster Road, $29,900

SS Home Builders LLC to Darrick Boyd, 614 Benja-min Drive near Richmond, $184,000

Payne Homes Inc. to Clay W. Sizemore, Megan B. Sizemore, 112 Ivy Creek

Drive in RichmondEric S. Lorden, executor,

Rosanne B. Lorden Estate to Martin Houses LLC, property in Red Lick area, distributing the assets of the Estate of Rosanne B. Lorden

Minerick Lane & Cattle LLC to Chenault Land and Cattle LLC, property on waters of Silver Creek, $775,000

Greg H. Peck, Rhonda M. Peck to Nathan A. Zornes, Lura K. Zornes, Tract 4, Shirley Durbin Subdivi-sion on Union City Road, $75,624

Leslie J. Harrison, Cas-sandra Harrison to Rocky Anglin, Christen Anglin, f1099 Gabbardtown Road in Berea, $15,000

Paul Shannon Johnson, Malvin Douglas Roberts, Lynda Keen Roberts to De-vere Properties LLC, prop-erty near Richmond on Barnes Mill Road, $450,000

Robert L. Lyons to Go-erge Earnest McMakin, Linda L. McMakin, Lot 18, Shiloh Crest Subdivision, $250,000

Stant Sowers to TR Real-ty LLC, Lot 80, South Blue-grass Junction, $105,000

David Bruce Fraley, Lin-da Fraley to Cristhian Sa-via, Christy A. Savia, prop-erty near Walnut Meadow

Campground, $1David Bruce Fraley, Lin-

da Fraley to Cristhian Sav-ia, Christy A. Savis, Lot 16, Dogwood Heights Subdi-vision near Berea, $178,000

Timothy James Masthay, Amanda Kalyn Masthay to Robert Shane, Lot 94, Shiloh Point Subdivision, $480,000

John A. Adams, Sara E. Lemay to Logan Allen, Lot 74, Traditions at Parkey Falls Subdivision, $315,000

Crystal Griffin, Crystal Evans, Willie Griffin to Douglas W. Perry, Shellye Perry, 1132 College Hill Road in Waco, $106,000

WW Investments LLC to Geoff Marietta, Sky H. Marietta, Lot 15, 122 Bluebird Avenue in Berea, $149,900

Robert Mitchell Tate, Susan Tate to Secretary of Housing and Urban De-velopment, Tract, Madi-son County, valuable con-sideration and further consideration of the full cancellation of mortgage indebtedness now held by Kentucky Housing Corpo-ration

Terry Ray Rawlins to Tammy K. Daniel, 3310, 3318, and 3320 Old Irvine Road in Richmond, love and affection

B6 The Berea Citizen

Leola Hays, right, was the February winner of the My Citizen contest. Adver-tising Director Sheila John-son gives Leola her $25 prize.

Every month, a name is pulled from the people who have called in with the location of the small Citizen icon, that is hidden every week. So, can you find the Citizen?

Hays WinsCitizen Prize

Ella Quillen from Buf-falo Hollow in Berea cel-ebrated her 80th birthday at Mario’s Pizza on Friday, March 11, 2016.

She has been blessed with eight children, and five of them were pres-

ent for her birthday. There were four generations present at the celebration, pictured above.

Numerous other family members and friends were also present to celebrate the big day with Ella.

From left to right are Shawn

Hensley, Ella’s grandson; Shawn’s

daughter, Trinity; Barbara Potter

Alexander, Ella’s daughter, and

Ella Quillen.

Quillen Celebrates 80 Years

THURSDAYMarch 24,

2016Vol. 116, Issue 42


Inside





Our Staff

Teresa Scenters,

Publisher

Beth Myers,

Editor

Kim Kobersmith,

Critley King

Reporters

Keeley Johnson,


Sheila Johnson,

Advertising

Timothy Pack,

Graphic Design

50¢ Newsstand

Plac

e m

ail l

abel

her

e

Contact Us



Ph:859-986-0959Fax: 859-986-0960




Berea Kiwanis to hold 79th annual

Easter egg hunt Sat., March 26 at Berea Expansion Park at

10 a.m.Planning & Zoning Votes Against Manufactured

Homes in Residential Zones


Kids from elementary school on up to high school showed up with their ro-

bots in tow on Saturday, to try out the challenges.

Farristown hosted the competition; the first time it has ever taken taken place locally. Both Farris-

town and Madison South-er competed in the event.

Berea College partnered with the school. The tech-nology and applied design program built the tables

and the college handled the cost. Professor Jan Pierce brought her com-puter science majors to referee the robotic compe-tition.

“They were treated like royalty,” Pierce said chuckling. “They were brought pizza, homemade brownies. They had a great time.”


The Madison County Fiscal Court heard from the public information offi-cer for the Madison Count Rescue Squad at their meeting on Tuesday.

The officer reported that the service calls were con-tinually increasing. Be-tween 2010 and 2015, they responded to an average of

457 calls per year, and that number jumped to 748 in 2016. So far this year, they have responded to 131 calls.

“We do a lot more than vehicle accidents,” the public information officer said. “We do ground and water searches for missing persons, disaster response, and other responses for incidents such as train de-railments.”

They had a difficult time financially, since they lost two of their three rescue trucks in 2015. They lost one to a flood and the other to fire. They will have an-other rescue truck in May. The organization operates on community donations and fiscal court support.

Representatives from God’s Outreach in Rich-

County Hears from Rescue Squad, God’s Outreach

Berea Community students won the Destination Imagination State Chal-lenge this past weekend, March 19, with their creation and performance of a mystery story placed in the 1940s. They portrayed a jazz band of the times, with homemade instruments, and performed Four by Miles Davis. Clockwise from far left, Joseph Caudill in the plaid shirt, Gabriel Abaunza, Dante Clavere with the upright bass made out of an old trunk, Alex Mondine wtih a guitar made from a suitcase, Dakota Baker, and Hudson Campbell.

Farristown Hosts First Ever Robotics Competition


Manufactured homes will not be allowed in other zones in Berea, the Berea Planning and Zon-ing Commission decided Tuesday night.

“We’ve had a number of discussions about this,” Richard Olson, the chair of Berea P & Z said, “and

we’ve talked to builders, contractors, and others.”

Planning and zoning had been looking at the possi-bility of allowing manufac-tured homes, or what used to be called mobile homes, into other residential zones in Berea. The current city ordinance only allows manufactured homes in zones specifically zoned for such homes. There are

two in Berea.The Berea City Council

asked planning and zon-ing to look into it, after a citizen requested moving a manufactured home onto his property.

Olson listed some of the concerns they heard about manufactured homes, including whether they


Berea Community school board members received a treat on Mon-day night, with a perfor-mance by a school jazz band whose members made their instruments from wood, an old trunk, and an old suitcase.

The students in ques-tion were Kentucky champions of the Desti-nation Imagination State Challenge that took place on Saturday, March 19. Gabriel Abaunza, Dante Clavere, Hudson Camp-bell, Alex Mondine, Jo-seph Caudill and Dakota

SEE COUNTY, PAGE A9

SEE P & Z, PAGE 9

Farristown hosted the regional Robotics Tournament this past Saturday in their gymnasium. They had a team competing, along with Madison Southern students, top left, Daniel Wyatt and Lydia North. Berea College students were the referees for the competion.

Church on the Rock to Present Journey to the CrossBy Beth MyersCitizen Editor

After pulling in record crowds the past few years for their Christmas drive-through display, Church on the Rock on Highway 25 has decided to host a special Easter perfor-mance.

“People in our church are so wonderful,” Dana Sarver, who has overseen the displays, said. “They’re so full of ideas, and they will put in so many hours to do these displays with excellence.”

The Easter presentation, titled Journey to the Cross, will be held from March 24 – 26 at 7:30 p.m. each night. Cars can pull in on

Berea Team Wins State Challenge

SEE SCHOOL, PAGE A9

SEE CROSS, PAGE A9

C O M M I T T E D T O C O M P A S S I O N A T E S E R V I C E

©20

13 M

KJ M

arke

ting

“At those difficult times, we believe giving you our very best is the

very least we can do.”

When you need a hand to hold, an ear to listen, or a shoulder to lean on, we will be here for you.

“We’re here for you always...”616 Chestnut Street • Berea • 859-986-3115 • DavisandPowellFuneralHome.com

Left to right: Leonard Bratcher, John S. Walker, Jr., Marian Abbott, Greg Powell, Jim Davis

A2 The Berea Citizen Thursday, March 24, 2016Obituaries/Local News

Reppert Funeral Homea n d C r e m a t i o n S e r v i c e

110 N. Broadway, Berea, Ky 40403 • 859-986-3165

Traditional Services, Direct Cremation,Visitation/Funeral Same Day Services,

Entombment, Grave Side Services, Memorial Services, Green Burials, Preneed Options.Green Burials, Preneed Options.

www.reppertfuneralhome.com

Located in Historic

Old Town

Michael David Jackson

Boyd Alexander, 72, of Flat Gap Road, went to be with the Lord on Friday, March 18, 2016 at Ephraim McDowell Regional Medical Cen-ter in Danville.

Boyd was born in Jackson Coun-ty to the late Ike and Allie Rader Alexander. He retired from Nacco Industries, and was of the Chris-tian faith.

In addition to his parents, he was preceded in death by his son, Boyd Edward Alexander; three brothers, Elisha, Delbert, and Eligie Alexander; and one sister, Dessie Alexander Lamb.

He is survived by his daughter, Lesley (Ken Engle, Jr.) Alexander; one granddaughter, Allie Shaye Alex-ander; brothers, Dudley and Manford Alexander; and two sisters, Sadie Alexander Clemons and Sarah Alex-ander Parker.

Funeral services were at 2 p.m. on Tuesday, March 22, 2016 at Lakes Funeral Home. Burial followed in Pilot Knob Cemetery. www.lakesfuneralhome.com

Michael David Jackson, 54, of Richmond, died Wednes-day, March 16, 2016 at Baptist Health in Richmond. He was born in Berea to the late Elmer and Betty Ballard Jackson York.

Michael was a farmer, and a member of the Pentecostal faith. He was a very kind and generous person who was always trying to help others.

He is survived by two brothers, Darrell (Rebecca) Jack-son of Richmond and Adam (Lou) York of Berea; his former wife, Patty Jackson; and a host of nieces and nephews. He was preceded in death by James Wayne York and Teresa Marie Whitman.

Funeral services were at 2 p.m. on Monday at the Davis & Powell Funeral Home with Rev. Cecil Burns officiating. Burial followed in the Pilot Knob Cemetery. In lieu of flow-ers, donations may be made to the funeral home to cover final expenses. www.davisandpowellfuneralhome.com

Dr. John Sipple

Boyd Alexander

Owen Neal Ballard, 61, died Thursday, March 17, 2016 at Baptist Health in Richmond.

Mr. Ballard was a member of First Baptist Church at Fran-cis and Collins Street. He loved to spend time with family and friends. He was an avid billiard player and loved to fish.

Mr. Ballard was preceded in death by his parents, James William Warren and Bar-bara Jo Ballard Hocker, and one brother, Michael Bal-lard.

He is survived by his children, Aaron Williams of Berea, and Yolanda Williams and Shannisha Williams, both of Richmond; three brothers, Otis and his wife, Cynthia Ballard, Anthony and his wife, Donna Bal-lard, and Darryl Ballard, all of Richmond; one sister, Valerie and her husband, Frank Floyd of Richmond; and one granddaughter, DaShawnia Jackson.

Funeral services were at 12 p.m. on Wednesday, March 23, at First Baptist Church Francis and Collins Street with Rev. Robert R. Blythe officiating. Burial followed in the Madison County Memorial Gardens. Davis & Powell Funeral Home in Berea in charge of arrangements. www.davisandpowellfuneralhome.

Harold Wayne Smith, 74, of Berea, died Wednesday, March 16, 2016 at St. Joseph East in Lexington following a short illness.

Harold was a lifelong resident of Madison County, born December 24, 1941. He was the son of the late Lloyd and Mary Etta Lynch Smith. He was a retired employee of Hayes-Limmerz Corporation, and member of Hays Fork Baptist Church.

Harold was a member of Kingston Masonic Lodge #315 f&am, and former long-time member of Berea Masonic Lodge #617 f&am. He was proud of his younger days as a Berea College Agriculture Department employee, when he milked cows, worked crop fields, and showed the college’s prize cattle.

Survivors include his loving wife of 12 years, Nettie Ev-ans Potts-Smith; one daughter, Stacie (Floyd) Neeley; two stepchildren, Robin Potts-Stamper and Louis (Devona) Potts III; one grandson, Boyd Dillon Neeley; four step-grandchildren, Shaun Tyler Stamper, Todd Potts IV, Travis Potts, and DeLainey Potts; two sisters, Virginia Jackson and Phyllis Smith; and numerous relatives and friends. In ad-dition to his parents, he was preceded in death by his first wife, Wanda Gabbard Smith and one sister, Bernice Smith.

His funeral service took place at 2 p.m. on Sunday, March 20, 2016 at Reppert Funeral Home with Brother Sam Smith and Dr. Neal Prather officiating. Honorary pallbearers were deacons of Hays Fork Baptist Church, and lodge brothers from Kingston Masonic Lodge #315 and Berea Masonic Lodge #617.

In accordance with Harold’s wishes, entombment was private. The family welcomes floral tributes, and expres-sions of sympathy may also take the form of contributions to Hays Fork Baptist Church Building Fund.Owen Neal Ballard

Dr. John Sipple, 76, of Berea ended his journey here on earth at Baptist Health in Lexington.

Dr. John was born in New Richmond, Ohio, to the late Lou-is and Edith Beach Sipple. He moved to Berea and opened his chiropractic practice on March 1, 1969, where two of his sons con-tinue his practice today.

Dr. John was an elder and or-dained minister at the Community Christian Church in Richmond. His passions in life were his family and drag racing top fuel racecars.

He is survived by his wife of 55 years, Doris Pres-ton Sipple; five children, Sheryl (Dr. Dean) Kenny, Mike (Tina) Sipple, Dr. Dan (Vonda) Sipple, Dr. Chris (Melissa) Sipple, and Aaron (Carrie) Sipple; grand-children, Richard, Rhett, Bryce and Chase Kenny, Sa-mantha, Brett, Aaron Michael, Brandon, Austin, Alex, Chesney, Landon, Max and Gage Sipple; and three great grandchildren, Asa, Lena, and Eliza Kenny.

A celebration of life will be held Friday, March 25, 2016, at 4 p.m. at the Berea Church of God in Berea with Pastor Mitchell Tolle and Pastor Jonathan Sells officiating. The family will receive friends from 11 a.m. – 4 p.m. at the church. In lieu of flowers, the family requests that memorials in honor of Dr. John be made to the Community Christian Church Build-ing Fund, P.O. Box 1990, Richmond, Kentucky 40476.

Condolences may be left for the family at www.lakesfuneralhome.com

Harold Wayne Smith

Bonnie Jennings Welch, 88, of Los Lu-nas, N.M., went to be with her Lord on Sunday, March 13, 2016. She was born in Berea on March 29, 1927, to the late Milt and Ludie Jennings.

Bonnie was preceded in death by her husband of 57 years, David N. Welch. She is survived by her four loving daughters, Barbara Duerksen, Linda Dutton, Gail Waldron, and Sandy Klein; four sons-in-law; eight grandchildren; and seventeen great grandchildren.

Funeral services were at 10 a.m. on Thursday, March 17, 2016 at First Baptist Church Bosque Farms in Bosque Farms, N.M. Pallbearers were David Duerksen, Bruce Du-erksen, Deric Dutton, Chad Dutton, Tyler Klein, and Kristy Kountz.

In lieu of flowers, donations may be made to the First Bap-tist Church of Bosque Farms, Children/Youth evangelism camps. Arrangements are be-ing handled by the Noblin Fu-neral Service Los Lunas Cha-pel. An online guest register is available at www.noblinfuner-alservice.com.

Bonnie Jennings Welch

Evaleen Broughton Rogers, 70, of Berea, died Saturday, March 19, 2016 at her residence following a long ill-ness.

Evaleen was a Jackson County na-tive, born at Kerby Knob on July 20, 1945. She was the daughter of the late James and Dovie Clemmons Broughton. She was a homemaker, caregiver, and member of the Holi-ness Faith. Most of her life, she en-joyed being known as everyone’s mamaw or granny.

Survivors include her only daughter and caregiver, Wilma (Paul) Howard of Berea; three grandchildren, Anthony (Brandy) Howard, Linda (Brett) Parker, and William Howard; five great grandsons, Jaden Howard, Austin Howard, Brandon Parker, Trenton Parker, and Luke Parker; Jayden Alewine, who she loved as her great granddaughter; two sisters-in-law, Lavada Blevins and Trulla Faye Lamb; and numerous relatives and friends.

Evaleen loved every one and was loved by everyone who knew her. In addition to her parents, she was pre-ceded in death by her loving husband, Everett Rogers; six brothers, Earmon, Ellis, Ledo, Willie, Ed and Luther; and two sisters, Myrtle and Tressie.

Her funeral service was at 11 a.m. on Tuesday, March 22, 2016 at Reppert Funeral Home with Bro. Cecil Burns officiating. Burial followed in Berea Cemetery. Pall-bearers were Anthony Howard, William Howard, Brett Parker, Oscar Combs, Stephen Blevins, Gary S. Blevins, and Dale Potter. Honorary pallbearers were Ryan Combs, Tyler Boswell, Josh Gonzellas, Elias Gonzellas, and Austin Castle. Special little honorary pallbearers were Jaden Howard, Austin Howard, Brandon Parker, Trenton Parker, Luke Parker and Jayden Alewine.

Evaleen Broughton Rogers

The family of Rev. Lloyd L. Anglin extends with deep gratitude to the many people who

stood with us and supported us in numerous ways during the illness and loss of our loved one.We especially want to thank Dr. Patrick Kelleher, Dr. Donita Hardy, Dr. Melissa Knuckles, Dr. Bruce Barton, the staff of the emergency room, St. Joe Berea and Lakes Funeral Home.Words of comfort from Rev. Steve Hobbs, Rev. Kenny Davis and nephew Rev. Jerry Owens are still carrying us through.The precious songs of Chris Thomas and Rev. James Chrisman comfort us still.God bless each one of our many friends and family members.

Love and Prayers,Johnnie, Lynn & Malta

Carlos Powell age 85, died Tuesday March 22, 2016 at the Compassion-ate Care Center in Rich-mond.

Carlos was born in Mad-ison County to the late Clarence and Mary Nee-ley Powell, has was a local business man for many years in Berea, he was a member of the Berea Ma-sonic Lodge F&AM #617 and the Olieka Shrine. In addition to his parents Carlos was also preced-ed in death by a brother Chester Powell.

Carlos is survived by his children: Lester (Sandra) Powell, David M. Powell, and Carla (Glyndon) Reed all of Berea, his brother Russell (Sandra) Powell of Florida and 10 grandchil-dren, 15 great-grandchil-dren, and 1 great-great-granddaughter and his longtime companion Mar-lene Anglin.

Graveside services will be Thursday March 24, 2016 at 2 pm at the Madi-son County Memorial Gardens. Online condo-lences at www.lakesfuner-alhome.com.

Carlos Powell


Theft• On March 8, officers were called to AT&T because of a theft. A store employee reported that a display phone was stolen some-time during the day. The estimated loss was $492.99.• On March 9, officers were called to Family Auto Sales because of a theft. The vic-tim reported a shotgun sto-len from his vehicle. The estimated loss was $40.• On March 13, officers were called to Walmart be-cause of a wallet that was stolen from a shopping cart. The estimated loss was $90.• On March 17, officers saw a vehicle in the park-ing lot of Indian Fort The-ater with a broken win-dow. They contacted the owner and discovered that several items were missing from the vehicle. The esti-mated loss was $635.

Drug Arrest• On March 8, officers were called to the Berea Skate Park because of drug activ-ity. Officers located one of the vehicles involved driv-ing on Jefferson Street, so they conducted a traffic stop. With the assistance of police canine Parko, a small amount of marijuana and a handgun were lo-cated inside of the vehicle. Officers arrested Buddy Durham, 19, of Berea and charged him with posses-sion of marijuana and car-rying a concealed deadly weapon. • On March 17, a traffic stop was conducted on Mill

Street for a minor traffic of-fense. Officers located a small plastic bag with sus-pected heroin inside of the vehicle. Officers arrested Brian Hatcher, 32, of Berea and charged him with first degree possession of con-trolled substance -- Heroin.

Shoplifting Arrest• On March 11, officers were called to Another Person’s Treasure because of a female shoplifter in the store. She had concealed merchandise in her purse before attempting to leave the store. Also inside of her purse were several dif-ferent kinds of pills and a suboxone strip.

Officers arrested Chas-tity Smith, 41, of Berea and charged her with theft by unlawful taking -- shop-lifting, two counts of first degree possession of con-trolled substance, second degree possession of con-trolled substance, and prescription of controlled substance not in proper container.

Criminal Mischief• On March 11, officers were called to the White House Clinic because of a window broken out of a vehicle in the parking lot.

Alcohol Arrest• On March 12, officers were called to the 500 block of Highway 1016 be-cause of a man passed out on a front porch. He was unsteady on his feet and said he had been drinking. Officers arrested Keith Cates, 44, of Richmond and charged him with al-cohol intoxication in a public place.

A3 The Berea Citizen Obituaries/Local News Thursday, March 24, 2016


Graveside services for Dorothy Carmen Manucy Ch-isholm, 89, of Clarkesville were held on Tuesday, March 22, 2016 at 2 p.m. at the Veterans National Cemetery in Bushnell, Fla.

Mrs. Chisholm passed away on Thursday, March 17, 2016 surrounded by her loving family.

Born in St. Augustine, Fla., on January 21, 1927, Mrs. Chisholm was the daughter of the late Edgar and Mar-ion Roberta Gervin Manucy. She obtained her BA de-gree from Miami University and her MA from Eastern Kentucky University.

Mrs. Chisholm spent her entire career in education. She started in the elementary grades at Homosassa Elementary School in Florida, and later served as the librarian at Berea College. She was a member of Saint Johns Episcopal Church and was past president of the Cloverleaf Women’s Club.

In her spare time, Mrs. Chisholm enjoyed reading, history, and painting. In addition to her parents, she was preceded in death by her husband, John Hugh Ch-isholm.

Survivors include daughters, Deborah (Joe) Ch-isholm Durno of Mayo, Fla., Judith Tere Chisholm of Lake Worth, Fla., Janine (Jay) Chisholm Dillon of Grovetown, Ga., Roberta (Kevin) Chisholm Ruce of Arlington, Va., and Alison (John) Chisholm Anglin of Clarkesville, Ga., and five grandsons.

In lieu of flowers, memorial contributions can be made to the Augusta YMCA for the Kathryn M. York Adapted Aquatics Center. An online guest registry is available at hillsidememorialchapel.com.

Dorothy Chisholm

Paul Edward Anderson

Paul Edward Anderson, 71, hus-band of Maurine Anderson, died on Monday, March 14, 2016 after a brief illness.

Paul was born in Paint Lick to the late James and Hazel Starnes Anderson. He was an employee of Barnett’s Heating and Cooling. He was preceded in death by his par-ents, and his sons, Kevin C. Ander-son and Jeff M. Anderson.

Paul is survived by his wife of 30 years, Maurine Esposito Anderson; his daughter, Paula White; step-daughters, Loren Goodin and Tami Marie Valvano; his sister, Carol Whalan; his brother, Kenneth Anderson; and his first wife, Emma Brady Lee.

Memorial services were on Saturday, March 19, 2016 at 11 a.m. at Lakes Funeral Home. Online condolences at www.lakesfuneralhome.com.


www.BereaDrug.com

Best WishesBill!

Bill Broaddus has made

many friends during

his 41 years at

Berea Drug. All are

invited to stop in

and help us wish

him well as he

begins his retirement

on Thursday, March 31st


Mitchell Tolle

Tater Knob Pottery






Don’tmiss it!

Holy WeekSt. Clare

Catholic Church622 Chestnut Street • Berea

at

Holy Thursday Mar. 24 7 pm

Good Friday Mar. 25 7 pm

Easter Vigil Mar. 26 9 pm

Easter Mar. 27 9 am Spanish 11 am

Candle-Light Celebrationin Remembrance of

Kyle Bowman

There will be a candle-light and balloon release celebration this Saturday, March 26, 2016 at the Berea Community School football field at 7:30

pm. This will be to remember and celebrate what would have been Kyle’s 33rd birthday. We invite everyone out in remembrance of this great man, Balloons will be released and candles lit as the sun sets. We would like to thank everyone that loved Kyle. His heart was big enough to hold all of us and we know he loved each of you. Balloons and candles will be provided.





the


Berea


- Galatians 6:9







Opinions expressed on this page are those of the contributors and are not necessarily shared by the owners and

management of this newspaper.


From our readers

What Do You Know? In the photo to the left is an old Berea fire-

truck, from one of Warren Brunner’s photos. Can anyone identify the approximate year this would have been taken, or the two men in the photo? Any other history to share about the old Berea Fire Department? Write to [email protected].

Why promote flag that contradicts Berea’s traditions?


The two men who were featured in last week’s photo were, according to one reader, Pruitt Smith

on the left and Mark Clark on the right. Smith was in charge of plumbing on the campus of

Berea College, and Clark was in charge of paint-ing and maintenance.

Berea Citizen

The Berea Chamber of Commerce would have us believe that they want to include confederate flag merchandise at Spoon-bread Festival because of free speech issues. That’s nonsense.

The Chamber already prohibits free speech at Spoonbread. They already prohibit drug parapher-nalia, items of the occult, gambling items, martial arts weapons, pornograph-ic or hazardous products

such as fireworks. Personally I agree with

those restrictions. They are not areas I want showcased in a festival that welcomes tourists and celebrates Berea traditions.

However I do not un-derstand why the cham-ber considers confederate flag merchandise accept-able. Perhaps the chamber has forgotten what makes Berea unique. Berea was founded by John G. Fee with the goal of bringing Kentucky into the civil war on the Union side. Berea

College was founded to educate blacks and whites together. We have a long history of racial inclusion that makes us unique in the area.

Why in the world would we want to offend local cit-izens and tourists by pro-moting confederate flag merchandise that contra-dicts our long traditions? Surely John G. Fee is turn-ing over in his grave.

Doug HindmanBerea

Foolish to forfeit city support for symbol of hate

Dear Editor,

Like many citizens who respect the Founder’s system of limited govern-ment, I have become in-creasingly concerned over the last several years about the authoritarian bent of this small town’s chief ex-ecutive.

We have seen played out in the pages of the Citi-zen over the last couple of months Mayor Connelly’s latest crusade against our constitutionally guaran-teed freedoms; that being the attempt to compel the Chamber of Commerce to conform to his idea as to what is or is not an “accept-able” symbol of history. I encourage the chamber to stand fast, as the Constitu-tion is clearly on the side of individual liberty and not the rabble-rousers or a schoolyard bully in a bow-tie.

For those who just can’t believe the mayor could possibly be so cavalier about upholding his oath to protect and defend the Constitution, consider the following: In 2012, our state legislature enacted KRS 65.870 which reiter-ated the fact that only the people’s representatives in Frankfort could regu-late matters concerning

firearms. The law clearly gave inferior governmen-tal bodies within the com-monwealth six months to comply.

Ironically, when it comes to what is acceptable or un-acceptable public displays, the City of Berea has been in violation of state law for well over three years. In summer 2015, I inquired to the city parks director as to why the city had signage at all its public parks that spe-cifically forbade “Weapons or Firearms”? This citizen was then told new signs to replace the illegal signs were, “On order.”

Fast forward to noon-time on March 1, 2016. As my family and I walked through Memorial Park I had chance, separate meet-ings with both the parks director and the mayor. When asked again about the illegal signs, both cu-riously repeated the same “on order” story.

So, why will you find no such illegal signs at our city parks today (as I write this, only bare signposts re-main)? You will find them gone because I called the mayor’s hand by making a public records request for the purchase orders of new signs you and I had sup-posedly paid for last sum-mer. The mayor was sub-

sequently forced to admit there were no signs “on order.” I will let the read-ers draw their own conclu-sions as to what this says about the mayor’s veracity.

Whether it was the thought of being shack-led and frog marched like the “evil” Kim Davis (KRS 65.870 clearly defines the penalty for failure to com-ply with the law as “Offi-cial Misconduct,” punish-able by up to a year in jail) that brought the mayor into compliance, or just a guilty conscience is of lit-tle consequence. All that matters is mothers will no longer be led to believe it necessary to leave their .38 behind when watch-ing over their precious children at our city parks and you now have a fuller understanding about how Mayor Connelly (habitu-ally) attempts to subvert our Constitution.

I can’t speak to the qual-ity of Steve’s constitutional law education, but on the first day of my training, we were reminded the law isn’t what you “think” it is or “should” be; the law is what it is...and no man is above it.

Shane MorrisBerea

Why prohibit “magic” games and not flag?

Dear Editor,

I add my voice to the chorus of Bereans who agree with the Mayor and speak out against the sale or distribution of the Con-federate flag at the Spoon-bread Festival.

It is clear from history that the symbol of the South’s rebellion stirs emotions that are counter to what our democracy should be. Berea is better than that.

The Festival was a suc-cess in years past without

controversial products to sell. Making the flag an issue has already brought unfavorable publicity to the City and the Festival. What vendors do we think will flock to sell and dis-tribute their wares if they see the Berea Chamber as defending a symbol of racist thinking? Berea is better than that.

As past president of the Chamber, I can attest to the huge contribution that the City of Berea makes to the expenses, infrastruc-ture, security, and parking

management of the Festi-val. It would be foolish to forfeit that support to de-fend a symbol that causes hate and division. Berea is better than that.

The Chamber should think very carefully about this issue. If it wants mon-ey and support from the City and all its citizens, it seems to me that the best choice is to accept the Mayor’s reasonable con-tract terms.

Sandra BolinBerea

Mayor is not above the law


Dear Editor,

I have been very con-fused by the portrayal of the conflict over the Con-federate flag at the Spoon-bread Festival as a matter of free speech.

As I understand it, the Berea Chamber of Com-merce already bans par-ticipation by vendors that would do things like of-fer tarot card readings, sell “magic” type games,

or other things that the Chamber strangely asso-ciates with the occult or paganism (a religious per-spective protected by the First Amendment to the Constitution). Presum-ably they think that these types of activities offend Berean’s sensibilities so much that they need to be banned.

So I don’t see why the Chamber or anyone else should object to the ex-

clusion of the Confeder-ate flag on “free speech” grounds. The historical and cultural roots of the Confederate flag are objec-tively rooted in the actual slavery and segregation of our fellow American citi-zens, which I believe is far more offensive than play-ing cards. But I suppose the Chamber disagrees.

Jim ScheffBerea

Dear Editor,

As a citizen of Berea and a person who attends the Spoonbread festival every year, I urge the Chamber of Commerce to prohibit the sale of confederate flag merchandise. The reason I ask this is simple, this flag

is a symbol of racism and hate, for many people. In the same way the swastika is a symbol of racism and hate. The Spoonbread fes-tival should not become a vehicle for the sponsorship of hateful merchandise. Again, I urge the Chamber of Commerce to prohibit

the sale of confederate flag merchandise. Hateful symbols are not what the Spoonbread festival and Berea is all about.

Jessica SpencerBerea

Please prohibit sale of Confederate flag


Berea Police Release New Phone App

Next week, Berea Col-lege Theatre Laboratory will close their season with a production of Escape from Happiness, a play by George F. Walker.

The play opens on Tues-day, March 29, and runs to Saturday, April 2. All per-formances will take place in the McGaw Theater, Jel-kyl Drama Center prompt-ly at 8 p.m.

Tickets can be purchased at the box office Monday - Friday between 1 - 5 p.m., or one hour prior to each performance. Reservations can also be made over the telephone by calling 859-985-3300. Berea College students are admitted free of charge with a valid stu-dent ID as part of their stu-dent activity fees.

Escape from Happiness is the third part of a roaring comedic trilogy that deals with issues such as fam-ily relationships, abuse,

crime, police morality and more, while still manag-ing to convey messages of love and interconnected-ness. The play centers on a family living in a neigh-borhood in Canada that is growing more and more impoverished and crime-filled. Nora, the mother, lives with her youngest daughter, Gail, and “the man who looks like her husband,” Tom. When Nora and Gail return home one day to find that Gail’s husband Junior has been attacked and left for dead on the kitchen floor, they must call on the help of Gail’s sisters to get to the bottom of it. Anything to keep those untrustworthy cops from lurking around their house investigating.

Directing the play is se-nior theatre major Moriah Griffin.

“I first found this play while searching for a co-

medic monologue for act-ing class my freshmen year, and when I came across it I felt like I had struck gold. When I read it the first time I couldn’t help laugh-ing out loud, even though I was out in public, and now even though I have been working with this script for a few months I still find myself disrupting rehears-als with laughter,” Griffin said. “I think this script asks some very important questions without trying to shove the ‘right’ an-swers down our throats. I hope everyone who comes to see this production will laugh and find joy in the humor, but I also hope they walk away with seeds of new ideas about family relationships, individual moral responsibility, hap-piness and many of the other themes present in this show.”

Meet Brad Hylton, a lieu-tenant with the Berea Fire

Department.

When did you first consid-er becoming a firefighter? What drew you to the pro-fession? It was a thought early on in my life, but I never really pursued it until about age 20 when I became a vol-unteer. My family had been

a part of the fire service in Berea since the late 60s, and this, along with the opportu-nity to serve my community, drew me to this career.

What is the most reward-ing part of being a fire-fighter? Being there to help someone when they are in need, and seeing that they truly appreciate the service.

What is the strangest sit-uation you’ve ever faced in your job? I could never narrow it down to one situa-tion. I will only say it is hard to believe the situations peo-ple get themselves into, and that they are willing to call the fire department to help get them out of it.

Tell us about your family. My wife Amy and I have been married for 16 years. I have a daughter, Heidi, 14, and a son, Kenten, 11.

What is difficult about being a firefighter? See-ing families going through a bad situation or losing what seems like everything at the time.

Tell us something that most people wouldn’t know about you. I don’t know what this says about my life, good or bad, but I re-ally can’t think of anything that most people wouldn’t already know. Now people know I need to find a hobby.


whitesmemorial.weebly.com

Easter Sunrise Service7:15 a.m. March 27

White’s Memorial Presbyterian Church401 White Station Road, Berea, KY

Come out in the country to witness joy in the resurrection of Jesus.All are welcome. Light refreshments following worship.

This is a Berea Ministerial Association event.

Our Faith is 2000 Years Old. Our Thinking Is Not!

Celebrate Holy Week & Easter with a faith community that cares about ...

Unbounded Hospitality Thoughtful, Inspirational Faith Development

Passionate Worship Risk-Taking Mission & Service

Extravagant Generosity & Care in our Stewardship of Creation

Union Church March 24 7:30 pm Maundy Thursday Worship Service March 25 12:15 pm Berea Ministerial Association Good Friday Service 7:30 pm Concert & Community Sing - Jesus Christ Superstar ($10 adults) March 27 9:30 am Easter Egg Hunt & Kids’ Activities 10:30 am Celebration of the Resurrection! Easter Service for All Ages

www.union-church.org 200 Prospect St., Berea

MONEY FOR FARM IMPROVEMENTS AVAILABLE…

COUNTY AGRICULTURAL INVESTMENT PROGRAM (CAIP)

Applications will be available for Madison County’s CAIP to assist farmers in making important on-farm investments. Application Period: March 7 – March 25, 2016 No applications will be accepted after March 25, 2016. Application Availability: Madison County Conservation District Monday – Friday (8 a.m. – 4:30 p.m.) For More Information: Contact at 859-624-1981 x 3 or email [email protected]. All applications are scored, based on the scoring criteria set by the Kentucky Agricultural Development Board.

Madison County Conservation 1024 Ival James Blvd. Suite A1

Richmond, KY 40475 624-1981 x 3 855-706-7039

[email protected]

We would like to congratulateour daughter, Brittany Perkins of Berea, on her recent achievements /awards in the NACMAI Competition in Pigeon Forge, TN

Brittany was awarded “Female Entertainer of the Year” and she also received the “Horizon Award FemaleVocalist of the Year’’ 2016.

We are very proud ofher and we feel sherepresents Berea, Kentucky to its �inest.

Congrats Britt! We love you!

Escape from Happiness Performs Next Week

Berea residents can help address local hunger needs on Wednesday, March 30 by participating in the an-nual Empty Bowls event and meal.

The Empty Bowls event will take place from 5:30 p.m. to 7 p.m. at the Com-mons, located in the Woods-Penniman Building on the Berea College cam-pus. The idea behind Emp-ty Bowls is simple – in ex-

change for $10, guests will be served a meal of soup in a ceramic bowl made and donated by Berea Col-lege ceramics student vol-unteers or local potters. Guests keep the bowl as a reminder of all the empty bowls in the world.

All proceeds go to fight local and regional hunger through donations to the Berea Community Food Bank and other local food

banks. Tickets can be purchased

at the door on the day of the event, or from 11:15 a.m. to 12:45 p.m. and 5 p.m. to 7 p.m. at Berea Col-lege Dining Services, locat-ed in the Alumni Building.

For more information about this event, please contact Sheila Lyons at 859-985-3935.

Empty Bowls Event Next Wednesday

This week The Berea Police Department re-leased a smart phone app to help better interact with our citizens.

The app, titled “Berea Police,” is available for Apple or Android mo-bile devices. This app will provide the latest alerts, services, and in-formation wherever you are. It will allow citizens a quick easy way to stay informed on what is go-ing on in Berea, as well as tools for reporting illegal or suspicious activity.

Key Features: • Receive alerts

about important infor-mation in your area.

• Quick access to department services, residence watch, and city ordinances.

• “Pin Location” tool to aid in accurate crime reporting.

• Photo and voice notes to help you easily report a crime.

• One touch call-ing, email and location tab.

• Thank an Officer and Report a City Prob-lem contact forms

• Tips for staying safe, social media and much more.

Former Rockcastle County Judge-Executive Buzz Carloftis announced his candidacy for State Representative, District 71, in the May 17th Re-publican Primary.

Carloftis was the longest serving county judge in Rockcastle County’s histo-ry, having served over five consecutive terms. Dur-ing his tenure, Rockcastle County saw unprecedent-ed improvements and growth in infrastructure development and public financial investments for job creation.

Additionally, Carloftis is very interested in tour-

ism development, having grown up in his family’s business (Fort Sequoyah Indian Village, now the site of Rockcastle River Trading Company).

Carloftis has a bache-lor’s degree from Cumber-land College in German

and political science and a master’s degree from Eastern Kentucky Uni-versity in political science where he wrote a thesis on political assimilation.

District 71 covers all of Rockcastle, Garrard, and part of Madison counties.

Carloftis Announced Candidacy for State Representative, District 71

DRIVEWAY GRAVEL haul-ing & spreading. Residential 859-544-7730 35x17p________________________BEAUTIFUL LANDSCAPING,Ponds, waterfalls, edibles, natives. Pond cleanings & repairs. (606) 416-3911 Rock Castles Landscapingwww.rockcastles.net.42x6p


APARTMENT FOR RENT 1 BR, excellent location. Utilities included, $450/mo. $450 dep. No pets allowed. Washer/dryer hook-up. 859-314-4706. 39x4b________________________APARTMENT FOR RENT: Extra nice, 1 BR, quiet safe neighborhood, ideal for someone downsizing or retiring, must see. Extra nice. $475/mo. + dep., tenant pays all utilities or $595/mo. + dep., we pay all utilities. Taking applications now. 582-7224. 41xtfnb________________________APARTMENT FOR RENT:2 BR, 2.5 BA. Carpet & tile, stove, refrigerator, dishwasher. No pets. References required. 859-200-3592 41xtfnb________________________ APARTMENT FOR RENT: 1 BR, all utilities paid, no smoking, no pets, $600/mo. First and last month’s rent. 859-985-8741 or 353-7715 42x1b ________________________ STUDIO APARTMENT Small, nice for one person, near Berea College. Utilities included. No pets. $425/mo. + $400 dep. 859-302-5432. 42x1p

APARTMENT FOR RENT: 1 BR Effi ciency, near Berea College. Utilities included. No pets. $500/mo. + $450 dep. 859-302-5432. 42x1p________________________TOWNHOUSE FOR RENT:Nice, 2 BR, 2.5 BA, laundry room, appl., privacy deck. $525/mo. + dep. & ref. 986-2525 or 979-5999. 42x1b

HOUSE FOR RENT: 3 BR, 1 BA w/ utility room hw fl oors, unfi nished basement for storage, small out building. In between Berea & Richmond, next to Bluegrass RECC building, 2075 Berea Rd. $625/mo. $625 dep. No pets allowed in home. Available April 1. 859-302-1270 42x1b________________________HOUSE FOR RENT: 3 BR, 2.5 BA, 2 story, 1 car garage. Northway Dr. Brand new, No pets. $1000/mo. + $1000 dep. Serious inquiries only. 859-986-3389. 42xtfnb________________________HOUSE FOR RENT: Nice, 3 bed, 2 BA, brick house 110 Christmas Ridge $725.; Lg. 2 bed, 1.5 BA townhouse, 100-2 Morning View. $575.; All units have central heat & air. 986-2266. 12xtfnb________________________HOUSE FOR RENT: Nice 3 BR, 2.5 BA, 3 car garage. $1000/mo. + $1000 dep. 859-358-0201 40xtfnb ________________________BRICK HOUSE FOR RENT: 3 BR, 2 BA, full basement, screened- in porch $1000/mo. + $1000 dep. 859-358-0201 40xtfnb

COMMERCIAL SPACE: 3000 sq ft. warehouse w/ 2 overhead doors and offi ce space. Close to I-75. Call 859-661-2090. 39xtfnb

LEVI JEANS $29.99, Car-hartt Jeans $26.99- Napier Brothers, 35 Public Square, Lancaster, KY. 6xtfnb________________________WANTED TO BUY: Your Antiques and collectibles. Antique glassware, furniture, quilts, all types of military items, clocks, watches (working or not), coins, and paper money. All types of gold, silver scrap, cast iron banks, toys, lighters, crock jugs, cast iron skillets, marbles, pocket knives, fi shing items, Indian Arrowheads, and much, much more. Also buying partial estates. Over 25 years experience. Call: Clarence Reece at 606-531-0467 43xtfnb________________________FREE PIANO, you must move. 625-4824 42xff

NISSAN 350Z. Red, black leather interior. 2004 coupe with 70K. Six speed manual. Touring options. Looks, runs great. All touring options. $10,000 fi rm. 859 582-5806 42x4p

FOR SALE: Full breedfemale boxer pup, born 2-9-16. Fawn w/ black mask. $300. Call 606-308-1890 42x1p

HOSTESS NEEDED: Apply in person at Dinner Bell. 127 Plaza Dr. 40xtfnb ________________________TRUCK DRIVERS WANTEDContact Jerry Knowles 859-625-8312 [email protected] 41x2p________________________CDL-A DRIVERS: Tank and Hazmat required. Home every week. Solo and Team. Sign on Bonus paid at orientation. www.randrtruck.com Call Today! 1-866-204-8006 41x2p________________________HELP WANTED: Veterinary offi ce hiring vet techs and kennel help. Send resume to: PO Box 901 Mt.Vernon, KY 40456 42x4p

2 FAMILY YARD SALE: Men’s, women’s, and brand name kid’s clothes, kid’s toys, home décor. Fri. & Sat. 8-3. 115 Commerce Dr. Apt 1.

PLAZA DRIVESTORAGE

10x10 $35/mo • 10x20 $60/mo 10x40 $120/mo • 20x40 $180/mo

call/txt 200-7691, 582-4173


• APARTMENTS •





[email protected]





661-3259, 661-2306986-7692, 986-4095


____________________

Blakewood Storage

Units for Rent661-3259, 661-2306986-7692, 986-4095

• PETS •

• SERVICES •



• EMPLOYMENT •



Lancaster, KY





986-5644










Autumn Ridge







(859) 986-8894 or (859) 661-0036 (nights)





Call (859) 985-7077


for sale. $50,000.859-986-4095

Subscribe to the Berea Citizen today!Have the paper delivered right to your mailbox.

Only $26/year in Madison County$35/year elsewhere

Call Keeley (859) 986-0959





House for Lease




• LOT •

WILESTrailer Park

SPACE FOR RENT

859 661-3259 859 986-4095


859 661-0036

APTS &

• APARTMENTS •

• VEHICLE •

• COMMERCIAL •

Call (859) 661-0304 or (859) 625-2528





Davis$20 - $60859-582-9710Hwy. 21 West

115 Linda Ln.

Storage Units

• YARD SALE •

BRTODD INVESTMENTS


utilities included

2 BR Apartments

(859) 661-2950

• COMMERCIAL •











(859) 986-7765TDD: (800) 648-6056


The Berea Citizen is placed in

conformity to equal housing rules.

Piano TuningServices

&

Minor Repairsin homes, churches,

& schools

Roddy TatePIANO TUNING

Roddy Tate

779-3802

Nelson Tree Servicewill be conducting a job fair to hire experienced

Forepersons and Trimmers It will be held on

Tuesday, March 29 at 6pmat Comfort Inn & Suites

located at 1918 W. Hwy 192, London, KYMust pass drug screen. Check us out at www.nelsontree.com. EOE-AA: M/F/V/D Safety and Professionalism... It’s the Basics!



REALTY WORLD®

TM





Berea & Richmond


ONE OF OUR AGENTS!

Kim GipsonRealtor

859-200-1864


859-623-1900


859-623-1900



859-779-9935

Paul HobbsRealtor

859-979-3040

Jason WilsonRealtor

859-358-3016



859-625-2066


859-358-6083


Paula MooreRealtor

859-358-4481

Donna MabesRealtor

859-868-8847

Kenny HowellRealtor

859-979-0462


859-302-2762

Nathan HackRealtor

859-351-9303







•51FirstSt.$139,900MLS#53743


























Aaron HackworthRealtor

859-582-9953

Zac WynnRealtor

859-314-7454

702Carolina Ct.Mad.Co.NW

$25,000MLS#54203

206 Van Hook Ct.

Berea$126,900

MLS#54281Host:

Aaron Hackworth

NEW LISTINGS

NEW LISTING OPEN HOUSE SAT 2-4

NEW

NEW

1703Barnett Rd.Mt. Vernon$114,900

MLS#54333

1008Quincy Ct.

Berea$129,900#1605079

NEW

(859) 986-0373




(859) 986-0373859 200-2090


Witnessing a break in?With the holidays approaching, break ins are occuring more often.

Make sure you lock your cars and homes!

Call Central DispaCh for immeDiate poliCe response

623-1248 or 623-1269

Don’t let your home be burglarized

• Make your home look occupied all the time. Use automatically timed

lights and radios. Don’t allow phone ringers to be heard outside and never leave notes on your door.

• Make sure there is good lighting outside of your residence.

• Install motion detector lights.• Always lock your doors, and do

not hide a spare key outside.• Do not post your vacation times or whereabouts on

social media outlets.





859-986-84011-800-998-2063 • fax 986-6173

FosterRealtors®


320 PINE STREET PENDING $129,500 MLS#53192 Phil Malicote 582-8882 114/116 BAUGH ST. PENDING $79,900 MLS#52567 Phil Malicote 582-8882 119 LYNNE DR. New Construction 3 BR, 2 BA $196,900 MLS#53171 Phil Malicote 582-8882 138 LORRAINE COURT (Duplex) $92,500 MLS#53010 Phil Malicote 582-8882633 KING LUKE CT. (Kings Trace) 5 BR, 3.5 BA 1 acre $229,900 MLS#51812 Janet Bowman 302-3123645 WOODSIDE WALK (Condo) 2 bdrms, 2 bths $116,000 MLS#51922 Connie Lawson: 661-0285BOX 451 RT. PENDING MLS#51191 Janet Bowman: 302-3123 914 BIG HILL Rd Mt. Vernon PENDING $75,000 MLS#50950 Janet Bowman 302-3123 79 CENTRAL AVE. 2 bdrm, 1 bth $59,000 MLS#50551 Phil Malicote 582-8882



DETAILS! 859/986-8401


5115 WALNUT MEADOW RD. 1 1/2 Story, 5 BR, 3 1/2 BA, 1 acre lot. Finished 2nd Floor with plenty of room for 2 additional bedrooms if needed $269,000 MLS#54184 Phil Malicote: 582-8882 208 PEACHBLOOM HILL PENDING $138,500 MLS#54061 Phil Malicote: 582-8882 616 C. VALLEY DRIVE 3 BR, 3 1/2 BA Log Home 40 acres $325,000 MLS#53952 Janet Bowman: 302-3123 182 E. HAITI RD. 3 BR, 2 BA, Basement style apartment. A must see. $99,900 MLS#53922 Lisa Foster: 582-1010 1050 FREEDOM SCHOOL RD. Mount Vernon 3 BR, 2 BA Doublewide on 1/2 acre lot. $59,000 MLS#53836 Don Foster: 582-1100 212 ADAMS STREET 2 BR, 1 BA Located in Artist Area Old Town Berea. Garage/Workshop $59,000 MLS#53767 Sune Frederiksen: 248-0690 1019 HONEYSUCKLE COURT 3 BR, 2 BA, 1 Acre $125,000 MLS#53735 Phil Malicote: 582-8882 726/728 O’POSSUM KINGDOM ROAD 2 BR (possible 3rd), 1 BA Recently remodeled 2.5 acres with barn, storage shed. Includes a 1,936 sq. ft. commercial bldg. currently being used as body shop with ef-ficiency apartment. $179,900 MLS#53707 Phil Malicote: 582-8882 120 N. BROADWAY STREET Historic City Jail & extra lot. Totally Updated. Great for Retail or Office. $149,500 MLS#53663 Phil Malicote: 582-8882 110 PARSONS LANE (Mt. Vernon) SOLD MLS#53505 Janet Bowman 302-3123 126 MEADOWLARK DR. 3 BR, 1 BA, $81,900 MLS#53408 Candi Vester 224-6550, Amanda Hill 661-0460140 TREMONT DR. 4 BR, 3 BA full finished walkout basement 2 kitchens 1 acre $209,000 MLS#53250 K Fain 582-6502

106 EXETER AVE. $27,500 Middlesboro Janet Bowman 302-3123294 DOGWOOD DR. - 0.49 Comm. Lot $100,000 MLS#52820 Candi & Amanda 224-6550 or 661-04601 PAINT LICK RD. - 6.13 Comm. Land. $1,500,000 MLS#53821 Candi & Amanda 224-6550 or 661-04601 DOGWOOD DR. - 8.51 Comm. Land $2,100,000 MLS#53822 Candi & Amanda 224-6550 or 661-0460FARM/ 2325 PEGGY FLATS RD. 182.56 acres prime farm land located 2.3 mi. from I-75. Completely fenced, 3 ponds, gently rolling. $912,500 MLS#53761 Phil Malicote: 582-8882 FARM/ 405 LOCUST BRANCH ROAD 543 acre farm, 200 year updated log home, plus modern 6 year old home. 3 barns, 2 machine sheds. Stocked pond. Guest cottage $1,200,000 MLS#53543 Phil Malicote 582-8882FARM/ 1775 GUYNN RD. 120.55 acres located within 3 mi. of I-75 & Berea.Barns, ponds, pasture, tillable land, woods & wildlife $350,000 MLS#53401 Phil Malicote 582-8882 BREEZY HOLLOW RD. 7.98 acres cleared land. Several bldg sites. $32,000 MLS#53517 Phil Malicote 582-8882




(859) 986-9417home

(859) 302-8411mobile


(859) 986-9797



LAND

• 104 wooDS TRAIl | RIChMoND (DUPlEX) ........................REDUCED $159,900• 137 CRoSSING VIEw DR. ............................................................... SOLD $119,900• 911 GREENwooD DR... ......................................................................SOLD $169,900• 124 CENTRAl AVE. (DUPlEX) ......................................................... SOLD $89,900• 128 CENTRAl AVE. (DUPlEX) ......................................................... SOLD $89,900• 262 ShoRT lINE Pk. (15.25 ACRES) .......................................REDUCED $160,000• 270 wIllIAMS ST. (MT. VERNoN CoMMERCIAl) .......... REDUCED $69,900• 211 GlADES ST. ....................................................................................SOLD $121,900• 446 ChRISTMAS RIDGE RD. .............................................................SOLD $125,000• 420 PlUMTREE DR. (NEw ShINGlES) ...................................................... $127,900• 2800 RIChMoND ST. (RENFRo VAllEY) 1A. ......................REDUCED $119,000• 2780 RIChMoND ST. (RENFRo VAllEY) ............................. REDUCED $70,000





ALSO AVAILABLE...






Now Available (Homestead) 3 BR, 2 BA, 2 car garage, covered front and back porches, tray ceilings throughout. $169,900.

Kelly ServicesNOW HIRING!

Immediate openings in the Richmond/Berea Area!Production/Assembly Workers/Forklift Operators

10 - 12 hours shifts (mandatory overtime) 1st and 2nd shift placements $11.00 - $11.50 an hour

Call Kelly Services today to qualify for an appointment!859.624.1644

www.kellyservices.com

Gator Made Trailers will be hosting a job fair on April 2, from 8:00 am to 11:00 am at 1278 Highway 461, Somerset, KY. Hiring Experienced MIG Welders. Start earning $15.00 per hour with the

potential to earn $20+ per hour. Possible travel bonus up to $50 per week.Gator Made is a drug and alcohol free workplace and an equal opportunity employer.

Due to our expanding business needs, Toyotetsu America, Inc. (TTAI), an automotive parts supplier, located in Somerset, KY, is currently seeking applicants for the following positions:

Die Maintenance team member: Position requirements include: 3-5 years’ experience in die repair methods, including knowledge of grinding, polishing, welding techniques, crane operation and preven-tive maintenance. A two year machine tool technology certificate or equivalent experience in related field is required. Qualified candi-dates must be willing to work on 2nd shift Monday through Friday. Availability for daily or weekend overtime is also required. Starting pay range $17.20-$23.15/hr. (Based on Exp.)

Machine Maintenance team member: Position requirements include: general machine experience, knowledge of PLC’s and experience in hydraulics, pneumatics, robotics, resistance welding and electrical systems. Two year industrial maintenance degree/certificate required or equivalent experience in related field. Qualified candidates must be willing to work on 2nd shift Monday through Friday. Availability for daily or weekend overtime is also required. Starting pay range $16.70-$22.55/hr. (Based on Exp.)

Stamping Eng. Specialist: Candidates should have the ability to pro-gram and troubleshoot PLC’s, have good electrical/mechanical trou-bleshooting skills and be able to solve stamping problems and read die prints. CAD/CAM capabilities are a plus. Must be willing to do 90% hands on work and support and train team members. An Associate’s Degree in Industrial Technology or other Engineering related field pre-ferred, with 3-5 years’ experience in stamping methods and a strong background in press machines/dies. (Salary based on exp.)

Welding Eng. Specialist: Candidates should have a good under-standing of PLC’s, Schematics, Robotics, and Resistance/Arc weld-ing. Must be willing to do 90% hands on work, support and train team members and have good ability to troubleshoot. An Associate’s Degree in Industrial Technology or other Engineering related field preferred, with 3-5 years’ experience in welding methods and a strong background in Resistance Welding techniques. (Salary based on exp.)

Facilities Engineering Specialist: Job duties include, but are not lim-ited to, all levels of facility preventative maintenance/repair, general plant appearance, interacting with contractors and miscellaneous duties as assigned by Manager. ; Job requirements include a mini-mum of: Two (2) year Associate’s degree or five (5) years’ experience in Facilities Engineering or Facilities Maintenance. Candidate must have a background in electrical, mechanical, blueprint/schematics reading, hydraulics, pneumatics, HVAC, plumbing & etc. (Salary based on exp.)

TTAI offers a competitive starting wage, an excellent benefits package and a climate controlled working environment.Applicants will be required to provide proof of high school diploma or GED.All interested parties should submit a resume in person or mail/email to:

Toyotetsu America, Inc. (TTAI)Attn: Human Resources100 Pin Oak DriveSomerset, KY [email protected]

TTAI is an Equal Opportunity Employer. No phone calls please

A NURSING AND REHABILITATION FACILITY

Position Available Laundry AideFull-Time. (Will train)Full Benefit Package

Apply at: 1043 Brooklyn Blvd., Berea, KY 40403Telephone: (859) 228-0551

The Terrace is an E.O.E.


• Free Estimates


(859) 661-1005



859-792-4025

Chiropractic Assistant

Candidate must be energetic, person-able, and able to multi-task in a fast-paced environment.

Assistant will aid in exams, therapy and rehabilitation of patients in an office setting.

Interested candidates please email resume to [email protected].

ww

w.c

hiro

prac

tiche

alth

solu

tions

.org

FOR SALE


New Kitchen in 2014


859.625.4824

Suncrest Meadows



PRICEREDUCED!

(859) 986-0373




859 200-2090

Classified/LegalA8 The Berea Citizen Thursday, March 24 2016

ORDINANCE NO. 05 - 2016

AN ORDINANCE OF THE CITY OF BEREA, KENTUCKY, AMENDING ORDINANCE NO. 12 - 2015, PROVIDING THAT THE CODE OF ORDINANCES OF THE CITY OF BEREA BE AMENDED BY REVISING SECTIONS 56.001 - 56.003, PROVIDING FOR THE LICENSING AND REGULATION OF CERTAIN RESTAURANTS AND DINING FACILITIES FOR THE LIMITED SALE OF ALCOHOLIC BEVERAGES.

WHEREAS, pursuant to the provisions of Ordinance No. 12-2012, and KRS 242.1242, and pursuant to a local option election on April 3, 2012, which election approved limited sales of alcoholic beverages at qualified historic sites in the East Berea Precinct, the City Council authorized limited sales of alcoholic beverages at qualified historic sites in such precinct; and

WHEREAS, pursuant to Ordinance No. 12-2012, the City Council adopted regulations licensing such sales along with any other administrative regulations necessary for the enforcement or administration of that Kentucky Alcoholic Beverage laws; and

WHEREAS, a local option election was conducted pursuant to KRS 242.1244 on September 29, 2015, which election approved limited sales of alcoholic beverages at restaurants seating a minimum of fifty (50) persons and deriving a minimum of seventy percent (70%) of gross receipts from the sale of food; and it is the responsibility of the City to amend its existing regulations to assure the sale of alcoholic beverages in certain restaurants consistent with suchelection and legislative intent; and

WHEREAS, the City Council adopted Ordinance No. 12 - 2015 , amending the provisions of the Berea City Code to permit the limited sales of alcoholic beverages in conjunction with a meal; and

WHEREAS, it is necessary to amend the provisions of Ordinance No. 12 - 2015 and Sections 56.005(b) and (c) to restate the definitions of an “open bar,” and the Council desires to restate the provisions of the regulation of limited alcohol sales in restaurants to comply with Kentucky law;

NOW, THEREFORE, the City Council of the City of Berea, Kentucky, does ordain as follows:

SECTION ONEThat the Code of Ordinances of the City of Berea, Kentucky, be amended by revising ‘ ‘ 56.001-56.003 ofthe Berea City Code, such Sections to read as follows:

CHAPTER 56: ALCOHOLIC BEVERAGE REGULATION

‘ 56.001 PURPOSEThis Ordinance is adopted to regulate the sale of alcohol pursuant to KRS 242.185 242.042 and KRS 242.1244 in such manner as to effectuate the legislative intent permitting limited sales of alcoholic bev-erages in qualified historic sites and in certain restaurants and dining facilities seating a minimum of fifty (50) persons and deriving a minimum of seventy percent (70%) of gross receipts from the sale of food.

‘ 56.002 APPLICATION REVIEWNo alcoholic beverage shall be sold in the City, except as authorized under KRS KRS 242.185 242.042 and KRS 242.1244 and this Ordinance. Authorization under this Ordinanceshall be obtained only upon the City’s receipt and approval of an application in accordance with this Ordinance, The City’s issuance of a license, the receipt and approval of an application by the Kentucky Alcoholic Beverage Control Board (hereafter AABC@) in accordance with applicable law, and the issu-ance of a license by the ABC.Application submittal and review shall be conducted as follows:

a) Application and Fees. i) Persons requesting approval and a license authorizing the limited sale of alcoholic bever-ages in qualified historic sites pursuant to KRS 242.1242 242.1244, or limited sales of alcoholic bever-ages at restaurants seating a minimum of fifty (50) persons and deriving a minimum of seventy percent (70%) of gross receipts from the sale of food pursuant to KRS 242.042, and this Ordinance shall submit a completed application to be obtained from the Office of the City Administrator. The Office of the City Administrator shall determine the form of this application and the information required by it, which shall be reasonably calculated to permit a reviewing officer to determine compliance with this Ordinance, and in the form approved and accepted by the ABC. Any applicant utilizing the ABC form shall provide any additional information not otherwise required by the ABC form by supplemental attachment to the application. ii) Applicants for a license under this Ordinance shall pay a license fee of $ 1,200.00 pursuant to the provisions of KRS 243.070 and KRS 243.075.

b) Administrating Officer. The City Officer responsible for administering this ordinance shall be the City Administrator, or such employee as the Mayor shall designate. All

transactions required for compliance or enforcement of this Ordinance shall be directed to or issued by the City Administrator, or the employee designated by the Mayor. He or she shall review the applications along with supplemental information and issue licenses authorizing the limited sale of alcoholic bever-ages at qualified historic sites or limited sales of alcoholic beverages at restaurants seating a minimum of fifty (50) persons and deriving a minimum of seventy percent (70%) of gross receipts from the sale of food pursuant to this Ordinance. The City’s Administrator Officer and employees with duties arising under this Ordinance shall comply with KRS 241.180 and 190.

c) Forms. All forms reasonably necessary for the implementation of the Ordinance shall be pro-vided by the City Administrator.

‘ 56.003 ISSUANCE AND RENEWAL OF LICENSES

a) Issuance. Upon satisfactory compliance with all City imposed requirements, the City’s Admin-istrating Officer shall sign an acknowledgment of that compliance. The ABC shall rely upon that acknowledgment and may review the application for statutory compliance. Upon presen-tation of the ABC issued license, the City’s Administrating Officer shall issue the City’s license.

b) Renewal. A license issued pursuant to this Ordinance shall authorize the limited sale of alco-holic beverages at qualified historic sites or limited sales of alcoholic beverages at restaurants seating a minimum of fifty (50) persons and deriving a minimum of seventy percent (70%) of gross receipts from the sale of food for one year. The license may be renewed annually there-after upon a showing of compliance with applicable regulations and the payment of a renewal fee of$100.00.

‘ 56.005 OPERATIONAL REGULATIONS AND DEFINITIONS

(a) Hours of Operation. No licensee operating pursuant to this article shall be open for business earlier than 6:00 a.m., or later than 12:00 midnight; nor shall any licensee for limited restaurant sales serve any alcoholic beverages on Sunday before 12:00 noon.

(b) No licensee for limited restaurant sales may have an “open bar.” Any area for serving alcohol must be operated in connection with a restaurant and by the same owner or management. All areas for serving alcohol must be directly connected with a dining room and must be only a service area for patrons of the restaurant. The sale of alcoholic beverages is prohibited except during the time the restaurant is actually engaged in and open to the public for the serving of meals.

(c) Definitions. For purposes of limited restaurant sales, the following definitions shall(1) Meal: The portion of food taken at one time to satisfy appetite.” Webster’s New Collegiate Dictionary, page 712 (1976). “ Department of Revenue v. To Your Door Pizza, Inc., 670 S.W.2d 482, 484 (Ky. App. 1983).

(2) An “open bar” is a bar with unlimited alcohol sales; i.e., a facility that sells alcohol without food; or not purchased “in conjunction with a meal.” Any area on a premises licensed for limited restaurant sales shall only serve alcohol in conjunction with a “meal.”

SECTION TWOAll ordinances or parts of ordinances in conflict herewith are hereby repealed. This Ordinance shall be recorded in the Office of the Madison County Clerk and be published according to law.

FIRST READING: March 1 , 2016.

SECOND READING & ENACTMENT: March 15, 2016.

ATTEST: APPROVED BY:Cheryl Chasteen Steven Connelly, MayorClerk of the City Council

PREPARED BY:Jerry W. GilbertCorporation Counsel

The Housing Authority of Berea is in the public comment period for the 5 Year Plan and the Annual Plan. Both items are available for public review at the agency main office at 110 Orchard Street, Berea, KY 40403. The public hearing will be held April 26, 2016 at 7:00 p.m. in the Morgan Street Community Room.

Doris WyattExecutive Director

Housing Authority of Berea110 Orchard StreetBerea, KY 40403

859-986-4436

Notice is hereby given that Delta Natural Gas Company, Inc. with principal office located at 3617 Lexington Road in Winchester, Kentucky 40391, has filed an application with the Energy and Environmental Cabinet to install a natural gas line crossing at Hays Fork Creek in Madison County along Kentucky 3376 (Old Berea Road). The proposed Hays Fork Creek crossing is located 65’ northwest of the centerline of Kentucky 3376 (Old Berea Road) and 385 feet from the intersection of Kentucky 421. Any comments or objections concerning this application shall be directed to: Kentucky Division of Water, Surface Water Permit Branch, Flood Plain Management Section 200 Fair Oaks Lane, Frankfort, Kentucky 40601. Phone: (502) 534-3410.

PUBLIC NOTICEBerea Tourism Commission

RFQ for Advertising and Marketing ServicesThe City of Berea’s Tourism Commission is seeking a partnering agency to provide advertising and marketing services for the Commission’s “Where Arts Alive” brand. Agencies or individuals wishing to submit a RFQ may acquire instructions for the preparation of the RFQ by contacting Kerri Lee Hensley, Executive Director, Berea Tourism Commission, at 859-986-0765 or by emailing kerrilee@visitberea .com.

Submission of RFQ’s must be delivered by 4 P.M., on April 29, 2016, to the attention of Kerri Lee Hensley, Executive Director, 3 Artist Circle, Berea, Kentucky 40403. All materials must be placed in a sealed envelope and marked “RFQ for Advertising and Marketing Services.” The RFQ’s will be opened at 4:30P.M., on April 29, 2016. Questions and or information required to complete a RFQ must be directed to Kerri Hensley using the above listed contact information.

Steven Connelly Randy StoneMayor City Administrator

Section 00100Advertisement for Bids

Southern Madison Water DistrictUS 25/ RICHMOND ROAD WATER LINE RELOCATION

207 North Dogwood DriveBerea, KY 40403

Separate Sealed BIDS for the construction of US 25 I Richmond Road Water Line Relocation; KYTC Item No. 07-8505.00 will be received by the Southern Madison Water District, 207 North Dogwood Drive, Berea, KY 40403 until 11 :00 a.m. on April 7, 2016 and then publicly opened and read aloud.This contract consists of relocating approximately 1,350 L.F. of 4” PVC waterline and appurtenances.The CONTRACT DOCUMENTS may be examined at the following locations:SOUTHERN MADISON WATER DISTRICT, 207 NORTH DOGWOOD DRIVE, BEREA, KY 40403KENVIRONS, INC., 452 VERSAILLES ROAD, FRANKFORT, KY 40601F. W. DODGE/AGC, 950 CONTRACT STREET, LEXINGTON, KY 40505Copies of the CONTRACT DOCUMENTS may be obtained from Lynn Imaging, 328 Old Vine Street, Lexington, KY 40507 (859-226-5850) and www.lynnimaging.com upon payment of a nonrefundable price of $175.00 for each set plus any shipping charges.Each Bidder must accompany his bid with a Bid Bond in amount of not less than five (5) percent of the base bid. No Bidder may withdraw his bid for a period of ninety (90) days. The Bidder awarded the contract shall execute a 1 00% Performance Bond and a 100% Payment Bond and shall furnish insurance as required, in the General Conditions. This contract shall be completed within 30 calendar days after date of authorization to start work. Liquidated damages will be $600 per calendar day.Bidders must comply with the President’s Executive Order Nos. 11246 and 11375, which prohib-it discrimination in employment regarding race, creed, color, sex, or national origin. Bidders must comply with Section 3, Section 109, Title VI of the Civil Rights Act of 1964, the Anti-Kickback Act and the contract Work Hours Standard Act. Bidders must certify that they do not, and will not, maintain or provide for their employees any facilities that are segregated on a basis of race, color, creed, or national origin.Any bid that is obviously unbalanced may be rejected. Southern Madison Water District reserves the right to reject any and all bids and waive informalities. Small, minority and women’s busi-nesses and labor surplus area firms are encouraged to bid this project.

By: Larry Todd, ChairmanSouthern Madison Water District

• LegaL Notice •PLEASE PICK SIZE THAT BEST FITS YOUR PAPER

NOTICE OFPUBLIC HEARING


NOTICE OFPUBLIC HEARING NOTICE OF PUBLIC HEARING NOTICE OF

PUBLIC HEARING





The Public Service Commission of Kentuckyissued an order on February 5, 2016, sched-uling a hearing to be held on April 7, 2016,at 9:00 a.m., Eastern Daylight Time, in Hear-ing Room 1 of the Commission’s offices lo-cated at 211 Sower Boulevard in Frankfort,Kentucky, for the purpose of cross-examin-ing witnesses in Case No. 2016-00003,which is An Examination of the Applicationof the Fuel Adjustment Clause of KentuckyUtilities Company from May 1, 2015 throughOctober 31, 2015.

This hearing will be streamed live and maybe viewed on the PSC website, psc.ky.gov.

Kentucky Utilities Company220 West Main Street

Louisville, Kentucky 40202

The Public Service Commission of Ken-tucky issued an order on February 5,2016, scheduling a hearing to be held onApril 7, 2016, at 9:00 a.m., Eastern Day-light Time, in Hearing Room 1 of theCommission’s offices located at 211Sower Boulevard in Frankfort, Kentucky,for the purpose of cross-examining wit-nesses in Case No. 2016-00003, whichis An Examination of the Application of theFuel Adjustment Clause of Kentucky Utili-ties Company from May 1, 2015 throughOctober 31, 2015.

This hearing will be streamed live and maybe viewed on the PSC website,psc.ky.gov.



The Public Service Commission of Ken-tucky issued an order on February 5,2016, scheduling a hearing to be heldon April 7, 2016, at 9:00 a.m., EasternDaylight Time, in Hearing Room 1 ofthe Commission’s offices located at 211Sower Boulevard in Frankfort, Ken-tucky, for the purpose of cross-exam-ining witnesses in Case No. 2016-00003, which is An Examination of theApplication of the Fuel AdjustmentClause of Kentucky Utilities Companyfrom May 1, 2015 through October 31,2015.

This hearing will be streamed live andmay be viewed on the PSC website,psc.ky.gov.



The Public Service Commission ofKentucky issued an order on Febru-ary 5, 2016, scheduling a hearing tobe held on April 7, 2016, at 9:00 a.m.,Eastern Daylight Time, in HearingRoom 1 of the Commission’s officeslocated at 211 Sower Boulevard inFrankfort, Kentucky, for the purposeof cross-examining witnesses inCase No. 2016-00003, which is AnExamination of the Application of theFuel Adjustment Clause of KentuckyUtilities Company from May 1, 2015through October 31, 2015.

This hearing will be streamed liveand may be viewed on the PSCwebsite, psc.ky.gov.



The Public Service Commissionof Kentucky issued an order onFebruary 5, 2016, scheduling ahearing to be held on April 7,2016, at 9:00 a.m., Eastern Day-light Time, in Hearing Room 1 ofthe Commission’s offices locatedat 211 Sower Boulevard in Frank-fort, Kentucky, for the purpose ofcross-examining witnesses inCase No. 2016-00003, which isAn Examination of the Applicationof the Fuel Adjustment Clause ofKentucky Utilities Company fromMay 1, 2015 through October 31,2015.

This hearing will be streamed liveand may be viewed on the PSCwebsite, psc.ky.gov.



The Public Service Commis-sion of Kentucky issued an or-der on February 5, 2016,scheduling a hearing to be heldon April 7, 2016, at 9:00 a.m.,Eastern Daylight Time, in Hear-ing Room 1 of theCommission’s offices located at211 Sower Boulevard in Frank-fort, Kentucky, for the purposeof cross-examining witnessesin Case No. 2016-00003, whichis An Examination of the Appli-cation of the Fuel AdjustmentClause of Kentucky UtilitiesCompany from May 1, 2015through October 31, 2015.

This hearing will be streamedlive and may be viewed on thePSC website, psc.ky.gov.



The Public Service Commis-sion of Kentucky issued anorder on February 5, 2016,scheduling a hearing to beheld on April 7, 2016, at 9:00a.m., Eastern Daylight Time,in Hearing Room 1 of theCommission’s offices locatedat 211 Sower Boulevard inFrankfort, Kentucky, for thepurpose of cross-examiningwitnesses in Case No. 2016-00003, which is An Examina-tion of the Application of theFuel Adjustment Clause ofKentucky Utilities Companyfrom May 1, 2015 throughOctober 31, 2015.

This hearing will be streamedlive and may be viewed onthe PSC website, psc.ky.gov.



The Public Service Com-mission of Kentucky is-sued an order on Febru-ary 5, 2016, scheduling ahearing to be held on April7, 2016, at 9:00 a.m.,Eastern Daylight Time, inHearing Room 1 of theCommission’s offices lo-cated at 211 Sower Bou-levard in Frankfort, Ken-tucky, for the purpose ofcross-examining wit-nesses in Case No. 2016-00003, which is An Ex-amination of the Applica-tion of the Fuel Adjust-ment Clause of KentuckyUtilities Company fromMay 1, 2015 through Oc-tober 31, 2015.

This hearing will bestreamed live and may beviewed on the PSCwebsite, psc.ky.gov.

Kentucky UtilitiesCompany

220 West Main StreetLouisville, Kentucky

40202

The Public ServiceCommission of Ken-tucky issued an or-der on February 5,2016, scheduling ahearing to be held onApril 7, 2016, at 9:00a.m., Eastern Day-light Time, in HearingRoom 1 of theCommission’s of-fices located at 211Sower Boulevard inFrankfort, Kentucky,for the purpose ofcross-examining wit-nesses in Case No.2016-00003, whichis An Examination ofthe Application of theFuel AdjustmentClause of KentuckyUtilities Companyfrom May 1, 2015through October 31,2015.

This hearing will bestreamed live andmay be viewed onthe PSC website,psc.ky.gov.

Kentucky UtilitiesCompany

220 West MainStreet

Louisville, Kentucky40202

All Real Estate Advertising in

The Berea Citizenconforms to

Equal Housingguidelines

A one-year subscription to The Berea Citizen is only $26 for residents of Madison County. Call Keeley 859 986-0959

It’s Spring Cleaning time.Watch for Yard Sales in The Berea Citizen!

The Madison County Sheriff’s Office is host-ing the 1st Annual “Battle of the Badges” basketball tournament at Madison Central High School Gym-nasium on March 26, 2016.

All proceeds from the tournament will go to the effort of sending Officers to National Police Week in Washington D.C. from May 15 through May 21. National Police Week is dedicated to honoring all Law Enforcement Offi-

cers, but more importantly to honor those who have made the ultimate sacri-fice.

This tournament will consist of teams from lo-cal law enforcement com-munity. Madison County Sheriff’s Office, Kentucky State Police, Richmond Police Department, Berea Police Department, East-ern Kentucky University, and Madison County De-tention center will make up the teams participating

in this single elimination tournament.

The first game is sched-uled to begin at 2 p.m. Ad-mission is $5 and kids un-der the age of 10 are free. Concessions and a limited number of t-shirts will be available on game day.

Although the basket-ball skills may be lacking, please come out and sup-port a great cause and your local law enforcement.


Berea College Presents Dance Performance

Plan for the Upcoming US 25 Yard Sale

would change property values, what the rates of depreciation were, and some negative perceptions of manufactured homes.

The commission unani-

mously agreed to not change the current city or-dinance.

Olson pointed out that the manufactured homes, which did look just like stick homes, cost around the same so they did not afford a price reduction for people.

Planning and zoning also changed their meet-

ing time on the second and fourth Tuesdays to 6 p.m. instead of 6:30 p.m. This would allow staff to leave earlier, Olson said.

In other business:• Planning and zon-

ing waived the sidewalk requirement for Dale Ball-inger, who is building a warehouse for his busi-ness on Paint Lick Road

near Lee’s Chicken. Near the road, it drops to 25 – 30 feet, making it necessary to rebuild the road in order to construct a sidewalk. There were also no other sidewalks in the area, so it would not have connected to other blocks.

• Planning and zon-ing changed the area of the new city hall campus

on Chestnut Street to PSF (Public/Semi Public Fa-cilities). The City of Berea didn’t have to request the change, since they are gov-ernment, but they wanted to make the future land use map appropriate.

• A new cell phone tower was requested on 456 Paint Lick Road by W. Brent Rice of McBrayer,

McGinnis, Leslie and Kirk-land, PLLC. The landown-er was agreeable, and it should bring better cover-age to that area, Brent said. Verizon will be the initial carrier on the cell phone tower, and it will accom-modate up to three more carriers. Planning and zon-ing approved the request.

P & ZCONTINUED FROM PAGE A1

mond reported to the fiscal court that they were ready to move on phase two of the building project. They plan to apply for fund-ing from the Community Development Block Grant (CDBG) to pay for the ex-

pansion, and will bring a resolution to the fiscal court since they would serve as the pass-through organization.

They need to provide a 10 to 15 percent cash match for the grant, so they will be financing for the re-quired cash amount, and paying it back with dona-tions.

In other business:• Judge Reagan Tay-

lor signed a proclamation for Arbor Day, which will be celebrated nationally on April 29, 2016.

• Gary Folckemer from EKU Emergency Management proposed a “complete set of live tests of our mass communica-tion capability,” through the outdoor warning siren system. There are four si-rens located on the EKU campus; they would like

to do the testing in August. Folckemer said they want-ed to make sure the county had no concerns about the proposed testing.

• Madison Coun-ty Conservation District turned in their 2016-17 budget with no significant changes.

• Nola Newman from Berea was appointed to the Madison County Tax Assessment Board. John

Gillam just ended his sec-ond term, so he is required to step down before serv-ing another term.

• Judge Reagan Tay-lor changed the terms for the EMS board members, so members would alter-nate. William Bradley’s will expire in 2017. Randy Rigsby and Glenn Burckett were appointed for two-year terms.

• Jimmy Marcum

was appointed as a road commissioner.

• The Madison County Fiscal Court ap-proved their Mutual Aid Agreement with BGAD.

• The courthouse will close for half a day on Friday. The next fiscal court meeting will be on Tuesday, April 12.

COUNTYCONTINUED FROM PAGE A1

Baker created their own instruments as part of the “challenge” they worked on throughout the school year.

“Teams could pick their own team challenge from several different ones,” Destination Imagination coach Connie Mondine said. “They chose a fine arts challenge where they had to create an original mystery story before 1990, and all the costuming and language had to fit the cho-sen time period.”

The Berea Community team decided to create their mystery for 1940.

Since they were also re-quired to showcase some type of talent during the mystery plan, they decid-ed to go as a jazz band with homemade instruments.

“They’re all musicians, so it seemed like a great talent to showcase,” Mon-dine said.

The six students made an upright bass from an old trunk, using scrap wood, and the guitar was made from an old suitcase. They used weed whacker strings for both instru-ments. Drums were made from white plastic tubs and PVC pipes.

“They played a Miles Davis song, Four,” Mon-dine said. “They just loved all of it.”

They also found out that math was very important,

Mondine said, since they had to get the exact spac-ing for their instruments in order for the sound to work.

Because of this “excep-tional engineering and design,” the students also won the Renaissance Award in addition to tak-ing home the champion-ship.

School board mem-bers approved going to the Community Eligibil-ity Provision (CEP) start-ing next year. This provi-sion allows every child in the school to receive a free breakfast and lunch. Schools are eligible if they have a certain percentage of students who receive free or reduced meals.

“The only downside to this is making sure you

receive enough reimburse-ment to cover costs,” Berea Superintendent Mike Hogg said. “But I’m sure we’ll see an increase in break-fast, which will off-set our losses from the part- and full-pay students.”

School board members Will Bondurant pointed out that many parents wouldn’t go on the free or reduced meals because of pride, and this way their children could still have full meals. Hogg agreed, stating that many kids wouldn’t get meals once their parents owed a great deal of money to the school. This way, all Berea students could always eat.

The last school day for Berea Community will be May 26, which is approxi-mately a week later than

planned in the school cal-endar. Graduation will take place on May 27. Staff will work from June 1 – 5.

The school also ap-proved school calendars for the next two years, to give parents more time to plan. The beginning day for the fall of 2016 is Au-gust 9, with fall break from October 3 – 7. For the cal-endar in 2017-18, school will not start until August 15, to stretch out the sum-mer so that work on the new HVAC system will be completed before the start of school. Because of this late start day in 2017, fall break for that year will be shorter.

Several juniors and se-niors were inducted into the National Honor Soci-ety on Monday night, in

a ceremony that current society members conduct-ed. The students inducted were Jordan Adams, De-nise Burdine, Carissa Coy, McKenzie Daughtery, Malcolm Davis, Candace Elam, Dalton Gadd, Alex-andria Horn, Sam House, Austin Jennings, Jared Kilgore, Mallory Lakes, Jennifer Lee, Catrina Mc-Collum, Wynn McDonald, Katie Okumu, Vanessa Patel, McKenzie Perry, Patty Phillips, Elvia Rojas, Maria Rojas, Olivia Reyes, Ty Robinson, Karmadri Santiago, Cherish Simp-son, Chloe Skeese, Jayson Smith, Roy Smith, and Isa-bella Whatley.

SCHOOLCONTINUED FROM PAGE A1

those nights, and drive slowly around to witness the 20 live scenes.

“There are around 240 people volunteering for this,” Sarver said. “There were approximately 6,000 people at our Christmas displays, and we’re expect-

ing around that much for Easter.”

People from the church built all the scenes, and they also made their own costumes. Live animals will also be present such as lambs, llamas, sheep and donkeys.

The scenes will go from “manger to tomb,” in Je-sus’ life, and each scene will have a narrator and a lamb. There will also be

multiple videos to watch while driving around the display, or waiting to drive through.

Sarver did give a parent advisory, however, that there would be a real por-trayal of the crucifixion. While there would not be people actually hanging from the crosses, they also will not gloss over the fact of Jesus’ death.

CROSSCONTINUED FROM PAGE A1Early in April, Berea

College’s Artists in Mod-ern Motion will present Kinetic Expressions 2016.

There are three evening performances scheduled from April 7 - 9, Thursday through Saturday, all be-gining at 8 p.m. A family friendly matinee is sched-

uled for 3 p.m. on Satur-day, April 10.

Tickets are $7 for gen-eral admission, with Berea College students getting in free. This year’s concert consists of dances cho-reographed by students and faculty. The guest art-ist will be Adalhi Aranda

Corn, the founder and di-rector of Bluegrass Youth Ballet in Lexington.

To order tickets, please contact Sarah Downs at (859) 985-3738. She can also be reached at [email protected].

Law Enforcement to Battle Out on the Basketball Courts

Curtis Penix from Mich-igan returns to hike the Kentucky portion of the original Boone Trace from Fort Boonesborough, near Winchester, through the Cumberland Gap to Mar-tin’s Station, located in Lee County, Virginia from April 2 through April 10.

Penix and Givan Fox had hiked the Trace from Kingsport, Tenn., over 16 days in March 2015.

Penix’s fifth-great grandfather, Joshua Pe-nix, came with Daniel Boone along Boone Trace in 1779 and it has been Penix’s wish to continue to walk in the steps of his great grandfather. It has never been “hiked” north to south in modern times and this hike will be again

somewhat of a research expedition. It can be fol-lowed on his web site www.lostinthewander.com where daily blogs will be posted and a schedule of his camp sites will be available. A map with a GPS locator showing his position in real time as the hike progresses will also be available to view on the website.

Boone Trace was opened by Daniel Boone and his trailblazing party during March and April 1775 and was the first road, EVER, into the land that was to become Kentucky. It is of enormous historical sig-nificance to the found-ing of Kentucky, but also the opening of the entire west. It is also frequently

confused with the Wilder-ness Road which evolved out of Boone Trace later in 1796.

Penix is a member of the Friends of Boone Trace, Inc. whose mission is to support the hike and save the remnants of Boone Trace while elevating awareness of its historical importance. Avid hikers that would be interested in preserving a part of his-tory are invited to join the Keepers of Boone Trace. Members will adopt por-tions of the Trace and help maintain and preserve it for another 200 years. Any interested hikers can con-tact Penix through his web site or Friends of Boone Trace online at www.boonetrace1775.com.

Penix to Hike Boone Trace Again

June 2 - 4, 2016 will be a busy weekend, as the US 25 Yard Sale holds its 5th annual event.

Stretching 565 miles from Woodfin, N.C. & Rocky Top, Tenn. to Richwood, Ky., this event has quickly become the nation’s 4th longest yard sale event as well as one of Berea top drawing events, with sev-eral hundred carloads of shoppers visiting town each day.

The goal is to get folks off the interstates and get them to slow down and visit our downtowns. And we encourage local resi-dents to have a huge yard sale to get folks to visit. Almost very city, village and town along the route participates. Maps of the route in each state are on the Facebook page and are available to download or use with your smart

phone. It’s a great opportunity

for nonprofits, church and school groups to set up shop and make some mon-ey. And now is the time to start organizing personal sales. If someone would like to participate, consult local officials as to permit requirements, set up le-gally and safely along or close to US 25, price it to sell and go for it. You will have more luck if you set up on at a site along the main road or use extra vis-ible signage, because get-ting these shoppers off US 25 and down a side road will be tough. They’re on a mission!

And remember—Thurs-day is a BIG sales day—if you’re not set up Thurs-day, you are going to miss several hundred shoppers. And—we already have a couple of local venues

lined up for vendors to rents spots along US 25 in town. So, the event seems to be catching on with folks. Our Facebook fans grew 6-fold in 2015.

No use of the US25 right-of-way is permitted and those who set up to sell must control parking and are responsible for clean-up when you are finished. It is a free event. If you own property on US25 & are renting out spots, we would recommend secur-ing a modest-refundable clean-up fee from those you rent out to.

Go to our Facebook page, “Like and Share” it and find info, hot spots lists and maps of the route at https://www.facebook.com/U.S.25YARDSALE Ya’ll come! On down US 25!

The above first graders in Mrs. Sharon Clark, Mr. Josh Shockley and Mrs. Tonia Middleton’s classrooms were recognized through Paint Lick Elementary School’s “Spotlight on Success” program. The students are having an exceptional school year. They are hard workers, great readers and complete their homework. Congratulations to these students.

Students Recognized for Hard Work

Wesley Morgan seeks Republican nomination for the Kentucky State House of Representatives, 81st District.

Morgan is a Richmond business owner and has lived in Richmond for 34 years. He is married to Lindsey Morgan and is the father of two daugh-ters, Jordan, 26, and Syd-ney, 8.

Wesley graduated from Leslie County High School. He attended Cumberland College in Williamsburg. While at Cumberland, he earned a bachelor’s degree in po-litical science and history; becoming the first person in his family to graduate college. Soon after, he attended EKU where he earned a bachelor of busi-ness administration in ac-counting.

Wesley Morgan will host a Campaign Kick-Off Rally on Thursday, March 24 at 6 p.m. at his home in Richmond. Congressman Thomas Massie from Ken-tucky’s 4th Congressional District will be his spe-cial guest. The rally will be an all ages event with

chili, snacks, and refresh-ments being served. For more details and the ad-dress of the rally, please contact Campaign Man-ager Dustin Isaacs at [email protected] or call 606-493-8193.


Madison County Special Olympics Team Wins Gold



WelcomeDAVID



We Offer• FREE Vitamins




Open 9 - 6 Mon.- Fri. 9 - 1 on Saturday


EASTER SUNDAY BUFFET

Turkey & Dressing • Fried Chicken • Roast BeefHam • Homemade Veggies & Desserts • Soup & Salad Bar

…and MUCH more!

GRILL, STEAKHOUSE & BUFFET

359 Peggy Flats Rd, Berea, Exit 77 (859) 986-0830

Easter BuffetHours

11:00 am to 8:00 pm

Breakfast BuffetHours

7:00 am to 11:00 am

Carry-OutAlso

Available



00859-986-3301222 E Haiti Rd.

COPE’S GarageOn Sunday, March 13 the Madison County Mus-tangs 1A Special Olympics team won gold at the 2016 State Basketball Tourna-ment at the MidAmerica Sports Center in Louis-ville.

Coach Shaun Stull said, “Our boys played their hearts out and I am incred-ibly proud of each and ev-

ery one of them. Our team has genuinely enjoyed ev-ery game they have played and, win or lose, it has been a terrific season and we can’t wait to get back on the court next year.”

The Madison County Special Olympics are thankful to the community for all of the support re-ceived.

In the bottom row, left to right, are Chase Barnes, Joel Roberts, Shane Stull, David Fish, Cody Lashelle, and Eric Isaacs; and in the top row are Robbie Ashcraft, Jacob Evans, Randy Murrell (Coach), Shaun Stull (Coach), Sonya Stull (Coach), Ronnie Lane, Joseph Reynolds, and Troy Murrell.

For the second year, Bob-town Arts, a non-profit ce-ramic studio, has received support from the Appala-chian Fund of Berea Col-lege.

A matching grant of $6,500 for the construc-tion of a gas kiln followed the 2015 grant which pur-chased four new wheels to expand the teaching pro-gram. Bobtown, located four miles from the city of Berea, was established on a 21-acre farm in 2013 by Clarence and Vicky Hayes. The arts program has com-pleted the first phase of their broader goal by pro-viding a free pottery stu-dio, complete with wood fired kiln, for any interme-diate ceramic artist who needs space, materials, and equipment to partici-

pate in clay art. Master potters Philip

Wiggs and Clarence Hayes designed and built the ef-ficient kiln that uses waste wood from lumber yards and waste vegetable oil.

The Bobtown potters have included diverse art-ists from Madison and Es-till Counties and students from Berea College’s ce-ramic program. The artists focus on high-fired glazes, which produce the most artistic decoration and fin-ish for clay ware, and ori-ent young potters to the technical and aesthetic components of ash and salt glazing.

This spring, a beginning, six-week throwing course is being taught by Clarence Hayes each Tuesday. It will launch on April 12. For

more information on how to access the free studio or register for a course, call 859-985-2747. Monthly fir-ings are also listed on the website, bobtownarts.org.

Spring wood firing will be held April 1-3, with kiln opening at noon on April 5.

Visitors are welcome to tour the studio and the working farm and meet the local artists each Satur-day during open studio.

Bobtown Arts long term mission is to create and support a vibrant commu-nity of diverse artists, clay artists, writers, musicians and visual artists who share studio space, mate-rials, and inspiration. The belief is that art can change the world, one artist at a time.

Bobtown Arts Receives Grant

Morgan Seeks Republican Nomination for 81st District

BUSINESS


SEE RESTAURANT, PAGE B7

King’s Eye Care






PLANS ACCEPTED

“What are your plans for Easter

weekend?”

Tony Pigg said, “I’m going to spend time with my grandchildren.”

Will and Alex Holbrook said, “Going to Ma Maw’s in Fleming-Neon to dye Easter eggs and see the Easter

Bunny.”

Wesley and Lainey Alexander said, “We’re going to hunt Easter eggs

at church with our cousins.”



Like Us On

(859) 986-0175208 Pauline Drive, Suite F PEOPLES

BANK

Photos by Kim Kobersmith/The CitizenThere are several new restaurants or food businesses looking to open in Berea, in-cluding Native Bagels from Katie Startzman, left, who shares some samples with Mike, Julianna, and Cooper O’Brien. To the right, Tricia Taylor stands by some

of the loose leaf teas she serves in her gallery/tea and coffee shop in Herb and Willow located in Old Town.

By Kim Kobersmith

Citizen Reporter

Those who like to go out to eat in Berea are about to have a lot more options.

New food places, in-cluding a rolling bagel cart, a Japanese steak-house, a hometown café with a healthy twist, and a Thai-inspired noodle bar all plan to open in the next few months.

Some folks might not have had the chance yet to check out Herb and Wil-

low, the latest drink and snack place to open in town. Business part-ners Tricia Taylor and Sam Moody opened in late November at 136 North Broadway. They serve custom-blended loose-leaf teas, locally roasted cof-fee, and baked goods from Clementine’s Bakery.

Taylor was part of the Arts Accelerator program last year and after comple-tion, she decided to stay in Berea. A potter, she want-ed to open a gallery space that would feature her

work and other up-and-coming art-ists not featured in existing gift shops. The beverages and baked goods help get people in to check out the art as well as providing a hang-out spot for people in Old Town.

Katie Startzman of Na-tive Bagel Company will begin to serve in mid-April. Her traditional ba-gels with a creative twist combine her Pennsylvania roots and current Kentucky home, including her nev-er-before-seen cornmeal

bagel. Her spreads i n c l u d e maple bacon and vegeta-ble cream cheese, and her sandwiches will feature seasonal local ingredients like eggs, greens, and pick-led vegetables.

While working as a net-ware designer, Startzman took the MACED entre-preneur class last fall hop-ing to develop a food busi-ness for her local, real-life community. Her bagels will be available via deliv-ery on a subscription basis and she will sell bagels

and sandwiches from her hot dog-like bagel cart at the Farmer’s Market and local events.

Street Side Café at 426 Chestnut Street will open in early May. Owner Linda Isaacs will serve Ameri-can food with a healthier twist including farm fresh and Kentucky Proud in-gredients. The burgers will be pure Black Angus and the sides will include broccoli and pasta salads. Isaacs wants everyone to

Through early detection treatment, the rate of colon cancer deaths can be sig-nificantly reduced.

To raise awareness of the importance of regular and early screenings, Saint Jo-seph Berea will have its inflatable colon on display at the Saint Joseph Berea Colon Cancer Prevention Event. The event will take place on Monday, March 28 from 9 a.m. to 4 p.m. on the front lawn at Saint Jo-seph Berea.

Kay Mullins, RN, and Mitzi Alexander, RN, both with Saint Joseph Berea, will be on hand to provide colon cancer awareness ed-ucation and to give a tour

of the inflatable colon on the hospital’s front lawn. Educational information about healthy diets and co-lon screenings will also be available.

The giant-size colon is 20 feet long, 12 feet wide and 10 feet tall. It allows people to walk through and see the types of issues a physician looks for dur-ing screenings, such as pol-yps along the lining of the colon.

Colorectal cancer is es-pecially prevalent in Ken-tucky, with incidence rates above the national aver-age. In 2013, Kentucky ranked fourth in the nation for colon cancer deaths.

The goal of the display is to reduce the rate of colon cancer deaths by helping people understand the im-portance of screenings.

Because individuals in the early stages of colorec-tal cancer often do not ex-perience any symptoms, regular screenings are crit-ical to catching the cancer before it reaches advanced stages or spreads to other areas. According to the CDC, colorectal cancer is the second leading cancer killer in the United States, and at least 60 percent of deaths from this cancer could be avoided if those aged 50 years or older had regular screening tests.

Is Berea Actually Getting (Gasp) Multiple New Restaurants?

Bagels?Japanese Steakhouse?

Thai Noodle Bar?

Coffee & Tea?

Giant Colon on Display March 28

Gyude Moore, the Minister of Public Works in his home country the Republic of Liberia, will speak at Berea College’s Service Convocation on March 24 at 3 p.m. in Phelps Stokes Chapel.

Moore, a 2006 gradu-ate of Berea College, was a political science major and now holds a mas-

ter’s of science in foreign service from Georgetown University. Moore will address the persistent patterns of power and privilege in communi-ties that are perpetuated through enforcement of clear lines of separation or “margins.” His as-sertion will be that the role of just people every-where is to regard mar-gins with skepticism and push them back further and further.

Republic of Liberia’s Minister of Public Works

to Speak

Farm Fresh Cafe?




NEWSPAPER








Local News

M A R R I A G E S

March 5Nitckia Aileen Santiago,

24, Lexington, housewife, to Jose Antonio Rubio Audelo, 34, Lexington, farmer

March 11Jordan Cheynne Patty,

30, Richmond, homemak-er, to Jason Timothy Mor-rison, 38, Richmond, avia-tion tech

Mackie Wayne Hud-dleston, 73, Brooks, retired, to Glenna Ruth Gray, 73, Waco, retired

March 12Sabrina Lynne Hall, 44,

Richmond, retail loss pre-vention, to Jackie Darnelle Hall, 40, Richmond, qual-ity engineer

Sarah Kaylynn Lykins, 25, Richmond, student, to Christopher Scott Wil-liams, 23, Richmond, fed-eral security guard

Sandie Marie Bryant, 54, Richmond, unemployed, to Ronald Lee Houck, Jr., 55, Richmond, heating and air

David Lawrence Lan-num, 53, Berea, service provider, to Traci Linn Reis, 51, Berea, federal agent

Lindsay Carol William-son, 23, Richmond, home-maker to Devon Stuart Johnson, 24, Richmond, carpenter

March 16Linda Carol Hender-

son, 47, Richmond, cook, to Thomas Ray Moore, 45, Richmond, disabled

Madison County Sher-iff Mike Coyle received a certificate honoring his late father, Maurice Coyle, and

his 70 years of membership in good standing to the American Legion Post 50. Members Chester Pow-

ell, far left, and Bill Wren, far right, were on hand to present the certificate to Sheriff Coyle.

Berger to Teach Watercolor Class

Deadline to order your Raised Garden Bed is April 1st, 2016.

WE do the installation at your

location for a 3’ X 5’ garden bed and fill it

with perfect soil for growing vegetables

and herbs.

YOU set the price on the sliding scale:

pay $25, $50, or $75 per bed

Call 859-985-1689 or email: [email protected]

Next Wednesday eve-ning, March 30, local artist Bob Berger will teach his first class in the watercolor series that the Berea Arts Council is sponsoring.

The spring class will meet on Wednesday eve-nings for six weeks, un-til May 11. The class will not meet on May 4. Par-ticipants will learn how to turn perception into water-color designs by develop-ing an artistic and focused observation. They will investigate the formal ele-ments of watercolor such as composition, space, form, color temperature and intensity, while main-taining an appreciation for

the immediacy of the me-dium.

Visit the Berea Arts Council website for more information and to down-

load the registration forms – www.BereaArtsCouncil.org or call 859-985-9317 for more information.

Coyle Recognized by American Legion

Madison County citi-zens who want to regis-ter to vote in the primary election must have their registration cards at the Madison County Clerk’s Office no later than Mon-day, April 18, 2016 by 4:30 p.m.

County residents may complete voter registra-tion cards at the Madison County Clerk’s office at the courthouse on West Main Street in Richmond or at the Berea Branch of-fice in Berea City Hall on

Chestnut Street in Berea. If a resident has moved,

he or she should change their address with the driver’s license office at 122 N. Second St. in Rich-mond. There will be a $13 fee. They should also stop by the county clerk’s of-fice by April 18 to fill out a new voter registration card.

In approximately two weeks, a notification post card will be sent with the name of the poling loca-tion and precinct. Please

contact the county clerk’s office if the card is not received after making an address change.

Knowing the name of your precinct on Election Day is an important part of each registered voter’s responsibility.

If you have any ques-tions regarding voter registration contact the Madison County Clerk’s Office by calling the Elec-tion Center at 859-624-4703 Ext 2.

Deadline Approaches for Primary Election Registration

Travel in song from de-spair to hope, from death to life on Easter Sunday, March 27 with the Berea United Methodist Church.

Join the journey that marches past a rug-ged cross and pauses in speechless wonder at

an empty tomb as the church’s adult choir pres-ents Song of the Lamb: An Easter Invitation.

The cantata was created by Marty Parks and is di-rected by music minister Mary Miller.

Berea United Methodist

Church is located at the corner of Chestnut and Fee Streets in downtown Berea. Services are 8:30 a.m. and 11 a.m. on Sun-day. For more informa-tion, please call 986-3485.

Berea Methodist Church Presents Easter Cantata

WOR

D S

EARCH


SUDOKU ANSW

ER:CROSSW

ORD ANSWER:

Answer: April Margera

Answer: Brendan Gleeson

Answer: Katy Mixon

Answer: Jack Antonoff

Answer: Hannah Spearritt

Guess

I was born on March 28, 1956, in Glen Mills, PA. I played Bam’s mother on

Bam’s Unholy Union.Who am I?

I was born on March 29, 1965, in Dublin, Ireland. I

played Michael Collins in The Treaty. Who am I?

I was born on March 30, 1981, in Pensacola, FL. I

play Victoria Flynn on Mike & Molly. Who am I?

I was born on March 31, 1984, in Bergenfield, NJ. I

play lead guitar for the band Fun. Who am I?

I was born on April 1, 1981, in Great Yarmouth, Norfolk,

England. I played Abby Maitland on Primeval.

Who am I?

who’sturning another year

older this week!March 27 – April 2

ACREARABSASIAATOMAVOIDAWAYAXLEBOXESCALLCRAZYCROW

CUBSCURIOUSDAMAGEDATADESIRABLEDYEDEACHEQUALEXITEXPLAINEDFEAR

FEWERFLASHFLEDFLOURFROGHERDIDENTIFIEDLAYSLEAKLUCKIERMATE

MICEMIGHTNICEROATHPETALSPOURRELATEDSAFESCRUBSEEDSSHOPS

SIDESLEPTSOUNDSPEECHSTATIONERYSTEELSUPERTHROWTHUDTILLTILT

TRUETYPEUNCLEVIEWWALKEDWASHWEEKWELLWORSEWRAPYO-YO

CROSSWORD PUZZLE

ACROSS

1. PLANT OF A CERTAIN FAMILY7. TRYING FOOD OR DRINK14. BREAD MAKER15. WORN ON THE CHEST16. LESS FRESH17. POISONOUS ALKALOID OB-TAINED FROM NIGHTSHADE18. IN RELATION TO BEING IN THE SENATE20. CALYPSO OFFSHOOT21. BACCHANAL22. EMINENT23. ACCORDINGLY24. “THE CATCHER IN THE ___”25. RATTY PLACE26. MULTIPLIED BY27. BAR28. MACHO GUYS (HYPHENATED)29. ANY “SEINFELD,” NOW30. MANAGEABLE OR IMPRESSION-ABLE31. PUTS AWAY32. NAVIGATIONAL AID33. EXPOSED34. BRAIDED STRINGS OF THIN ROPES

35. “___ NG” (THEY MIGHT BE GIANTS SONG)38. MICROWAVE, E.G.39. RECIPE DIRECTION40. HEATING DEVICE41. APPLY GENTLY42. WELL-KNOWN44. GET GOING46. COOKING UTENSIL COMMONLY USED DURING THANKSGIVING47. SOMEONE THAT SIGNED UP FOR A COURSE48. WHISTLER, E.G.49. GLOOM50. RESPONDS TO A STIMULUS

DOWN

1. SOMEONE WHO GRANTS A LEASE2. DINER3. A FARM4. TO UNTWIST A ROPE5. CONVENE6. CONTAINING ERROR7. TIE UP8. BITTER9. “CUT IT OUT!”

10. BLOUSE, E.G.11. MEN NATIVE TO THE EMERALD ISLE12. STURDY BUFF COTTON CLOTH13. EXTRACTS15. MANY A DEGAS19. THE EUROPEAN MOUNTAIN ASH23. KITCHEN COUNTER?25. BIT26. LARGE US STATE27. EVENING HOUR28. BICYCLE STEERING WHEEL29. AN UNCOMMON FLYING ANIMAL30. OBSERVATION, PART 331. TREELESS PLAIN32. AN EVENING PARTY33. MASSES OF PEOPLE34. _____ AND LADDERS35. RELATING TO THE HEART36. LIKE MISS CONGENIALITY37. ADVISORIES39. BARBECUE FUEL40. ___ DEL SOL42. GAME PIECE43. CHARGE45. ELEPHANT’S WEIGHT, MAYBE


9 3 4 2 1 6 5 7 86 8 5 3 7 4 9 1 27 2 1 8 5 9 4 3 68 7 6 4 9 3 1 2 54 1 3 5 2 7 6 8 95 9 2 1 6 8 3 4 73 4 7 6 8 5 2 9 12 6 9 7 4 1 8 5 31 5 8 9 3 2 7 6 4

SUDOKU


AND INFORMATION

CALL

SHEILA JOHNSON

986-0959

CryptoQuiz

She was the first woman to wina Nobel Prize:

____________________________________

Answers: 1) Poland, 2) Physicist, 3) Radioactivity, 4) France, 5) Radium, Marie Curie

Each of the following cryptograms is a clue to the identity of a woman in history. Using the hints E=A and C=D, decipher the clues to name the woman.

T I H E B C_______________________

T X Q M U R U M Z_______________________

V E C U I E R Z U N U Z Q_______________________

S V E B R F_______________________

V E C U A W_______________________

3

2

4

5

1

Whiten Your Smile

Help a Child



Melissa Jones, DMD



2




9 3 4

8 3 7 1 2

1 9

6 3 5

4 5 7 9

5 1 3

6 2

2 6 4 1 5

7 6 4











®-NO BULL-


Come See the





• Calvary Apostolic Church, 1350 Paint Lick Rd., Sunday worship 2 p.m., Pastor Josh Hampton. For de-tails, call 302-3926 www.cacberea.com




























































































REPLACEMENT RENTALS


(859) 986-7712


(859) 986-7595


(859) 985-2596


(859) 985-7371





office (859) 986-1802





P-CAB

986-1111



“Behold, we go up to Jerusalem; and the Son of man shall be betrayed unto the chief priests and unto the scribes, and they shall condemn him to death, And shall deliver him to the Gentiles to mock, and to scourge, and to crucify him:

and the third day he shall rise again.” -- Matthew 20:18-19




“I think that there’s something in the American psyche, it’s almost this kind of right or privilege, this sense of entitle-

ment, to resolve our conflicts with violence . . .To actually have to sit down and talk, to listen, to

compromise, that’s hard work.” -- Michael Moore


(859) 985-5577



[email protected]


























































Regular meetings

Calendar of eventsMarch 24• Berea College convo -- Gyude Moore to speak

on Courage in the Face of Radical Evil, 3 - 4:15 p.m., Phelps-Stokes Auditorium. Moore, Berea College graduate, serves as Liberia’s Minister of Public Works, and will speak on separation or “margins.”





• Free afternoon movie, 3:30 p.m., Madison County Public Library in Berea. Showing Mocking-jay part 2. Rated PG.


• Campaign Kick-Off Rally for Wesley Morgan for 81st District, 6 p.m., 1266 Willis Branch Road in Richmond. Will have chili, snacks, and fun for kids.

March 25• Teen Book Party, 3:20 p.m., Madison County

Public Library in Berea. Party based on graphic novels, with Man of Steel showing later.

March 26• Berea Kiwanis’ 79th Annual Easter Egg hunt,

10 a.m., City of Berea Expansion Park at the end of N. Broadway. For ages 0 - 10.

• “Battle of the Badges” Basketball Tournament at Madison Central High School Gymnasium. Teams from all branches of law enforcement in Madison County to battle on the courts. First game is 2 p.m. -- single elimination. $5 admission, kids free.

• See the Art, Meet the Artisan, 2 p.m., Madison County Public Library in Berea. The artwork of Cyn-thia Cusick will be presented.

• Contra Dance, 8 - 11 p.m., Russel Acton Folk Center. Caller Deanna Palumbo and band Decaf Zombies. Beginner lesson - 7:30 p.m. $8 for adults; $5 for students/seniors. Call 985-5501.

• Basketry Demonstration, 10:30 a.m. - 3:30 p.m., Kentucky Artisan Center.


March 27• Singing of cantata -- Song of the Lamb: An

Easter Invitation, 8:30 a.m. and 11 a.m., Berea United Methodist Church. Call 986-3485 for info.


Library in Berea. For ages 6 to 14 years old.• Aerobics, 5:35 p.m., Russel Acton Folk Center.


- 8 p.m., Intergenerational Center, behind Russel Acton Folk Center. No experience necessary. Join in the jam, 5:30 p.m. with beginners and 6:30 p.m. with intermediates.

March 29• Dramatic Portrayal of John G. Fee, 10 a.m.,

Boone Tavern. Obadiah Ewing-Rouse will perform, “Abolition . . . Amen!”, in his portrayal of Fee.


• Madison County Dulcimer Group Session, 1- 4 p.m., Intergenerational Center, behind Russel Ac-ton Folk Center. No experience necessary. Join in the jam, 1 - 2 p.m. with beginners and 2 - 4 p.m. with intermediates.

• Baby and Toddler Time, 10:30 a.m., Madison County Public Library in Berea. For ages 0 - 2 1/2.

• One-on-One Computer Help, 12 p.m., Madi-son County Public Library in Berea. Classes de-signed to answer all questions about computers.

• Doctor Who Listeners Club, 6 p.m., Madison County Public Library in Berea. Join the club for new Doctor Who audio plays each month.

March 30• One-on-One Computer Help, 12 p.m., Madison

County Public Library in Berea. Classes designed to answer all questions about computers.

• Crafternoon: Coloring Dinos, 3:30 p.m., Madi-son County Public Library in Berea. Add paint and embellishments to make dino perfect.

• Basic Spanish for Adults, 6 p.m., Madison County Public Library in Berea. Hispanic Outreach Project (HOP) offers ten-week Spanish course.

March 29 - April 2• Theater Performance - Escape from Happiness,

8 - 10 p.m., McGaw Theatre at Berea College cam-

pus. For ticket reservations, call 985-3300.

March 31• Berea College convo -- Karim Nagi speaks on

Arab Identity and the Arts: Diaspora and Outreach, 3 p.m., Phelps Stokes Auditorium. Nagi, musician and orator, speaks on misunderstanding of Arabs. Will perform Arab music and dance to educate.


• Free afternoon movie, 3:30 p.m., Madison County Public Library in Berea. Showing Grease LIVE. Rated PG.





April 2• Michael Combs in Concert, 7 p.m., Dixie Park

Cornerstone Church on N. Powell Ave. Love offering will be taken. 893-8086.

• Maker Mania!, 12 p.m., Madison County Public Library in Berea. Time to pull projects off the back burner to work on.


April 3• Chess Club, 1 p.m., Madison County Public Li-

brary in Berea. All ages and skill levels welcome.

April 4• Lego Club, 3:30 p.m., Madison County Public

Library in Berea. For ages 6 to 14.• Aerobics, 5:35 p.m., Russel Acton Folk Center.

$3 per class, or 10 visit punch card for $25.

April 5• Baby and Toddler Time, 10:30 a.m., Madison

County Public Library in Berea. For ages 0 - 2 1/2.• Madison County Dulcimer Group Session, 1- 4

p.m., Intergenerational Center. No experience nec-essary. Join in the jam, 1 - 2 p.m. with beginners and 2 - 4 p.m. with intermediates.








8:00 a.m.- 4:30 p.m.

BIG ONCOMMITMENT

AutoFarmHome


Business






Perhaps I can help.







Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



The Smith Group





April 8-10, 2016: Introduction to Throwing on the Potter’s Wheel, Teresa Cole, Instructor $100

April 9-10, 2016: Beginning Lamp Work Beads, Janie Miniard, Instructor $250

April 16, 2016: Fusing Glass 101, Janie Miniard, Instructor $85

April 16-17, 2016: Beginning Beaded Jewelry- Bracelet/Earring, Evelyn Schnee, Instructor $185

Four week class meeting each Wednesday in April: Digital Photography for the Everyday Person, Martha Wayland, Instructor $35




B6 The Berea Citizen Thursday, March 24, 2016Public Record

SEE PROP, PAGE B7


Marcy 18, 2016

March 12Jason Adams, 34, Slemp,

public alcohol intoxicaqi-ton

Stevan Saylor, 27, Paint Lick, fourth degree assault – domestic violence

Kenneth Slaughter, 25, Richmond, fourth degree assault – domestic vio-lence, second degree flee-ing or evading police

Jennifer Bogie, 34, Rich-mond, non payment of fines

Michael Mueller, 54, Richmond, theft of identity of another without consent

Bradley Montgomery, 46, Richmond, serving warrant for other police agency

Keith Cates, 44, Rich-mond, public alcohol in-toxication

Tonya Doyle, 36, Rich-mond, failure to appear

Jason Strange, 38, Maysville, second degree disorderly conduct

Joshua Raleigh, 26, Rich-mond, public intoxication of controlled substance, first degree possession of controlled substance – her-oin, tampering with physi-cal evidence

Amber Whittamore, 24, Richmond, first degree possession of controlled substance – heroin, buy/possess drug parapherna-lia

Aaron Raleigh, 27, Rich-mond, two counts of first degree criminal possession of forged instrument, il-legal possession of legend drug

March 13Christopher Keller, 27,

Richmond, careless driv-ing, operating motor vehi-cle under the influence of alcohol or drugs

Adam Reeves, 25, Corbin, disregarding traf-fic control device – traffic light, operating motor ve-hicle under the influence of alcohol or drugs

Serena Rader, 24, Lexing-ton, serving time

Britnay Richardson, 29, Richmond, theft of prop-erty mislaid or delivered by mistake

Michael Fryer, 27, Rich-mond, probation violation, leaving scene of accident – failure to render aid

Dustin Parrish, 27, Berea, two counts of theft by fail-ure to make required dis-position of property

Ricky Callahan, 45, Berea, two counts of non payment of fines

Lisa Bailey, 52, Rich-mond, non payment of fines

Nicholas Holliman, 27, Richmond, theft by unlaw-ful taking – shoplifting un-der $500

March 14Josh Owens, 28, Rich-

mond, theft by unlawful taking – shoplifting under $500

Roy Himes, 39, Paint Lick, serving warrant for other police agency

Aaron Ferrell, 26, Rich-mond, serving bench war-rant for court, serving war-rant for other police agency

Johnny Christopher, 42, Winchester, hold for court

Penny Wilson, 45, Berea, contempt of court

Christy Phillips, 32, Rich-mond, buy/possess drug paraphernalia

Charles Jackson, 30, Richmond, fourth degree assault – domestic violence

David Denny, 20, Rich-mond, non payment of fines

March 15Michael Lesko, 21, Rich-

mond, operating motor ve-

hicle under the influence of alcohol or drugs

Kathy Todd, 36, Paint Lick, failure to appear

Henry Chodakowski, 54, Richmond, serving time

Sue Stepp, 52, Irvine, probation violation

Sebrina Coffey, 22, Rich-mond, failure to appear, non payment of fines

Cassidy Mobley, 35, Richmond, parole viola-tion, failure to appear, theft by unlawful taking – shop-lifting under $500

Jeremiah Fout, 34, Rich-mond, receiving stolen property under $10,000

Hannah Barber, 22, Waco, third degree crimi-nal trespassing, second degree disorderly conduct, resisting arrest first degree promoting contraband

Jeremy Green, 30, Irvine, probation violation

Ashley Young, 30, Berea, forgery of a prescription, trafficking in prescrip-tion blanks for C.S., crimi-nal falsification of medi-cal records, third degree burglary, tampering with physical evidence, theft of medical records

Darryl Jones, 30, Big Hill, violation of conditions of release

Amanda Elliott, 31, Berea, violation of condi-tions of release

Karey Dillon, 40, Berea, possession of marijuana, non payment of fines

Sauntavious Wagers, 23, Richmond, fourth degree assault – domestic violence

Regina Felder, 29, Rich-mond, theft by unlawful taking – shoplifting under $500, non payment of fines, failure to appear

Dallas Collins, 39, Rich-mond, first degree pos-session of controlled sub-stance, buy/possess drug paraphernalia

Anthony Foster, 26, Berea, hold for court

Patrick Embry, 26, Berea, hold for court

Heather Lowery, 33, Berea, contempt of court, failure to appear

March 16Jeremiah Hunt, 27, Rich-

mond, fourth degree as-sault – domestic violence, menacing, resisting arrest

Joshua Hammons, 34, Richmond, first degree trafficking in controlled substance, two counts of first degree possession of controlled substance, il-legal possession of legend drug, buy/possess drug paraphernalia, third de-gree possession of con-trolled substance

Cassandra Mansfield, 33, Berea, hold for court

Moss Matthews, 41, Richmond, violation of conditions of release

Randall Smith, 57, Bar-bourville, non payment of fines

Jonas Murphy, 34, Berea, public intoxication of con-trolled substance, failure to appear

Brian Hatcher, 32, Berea, public intoxication of con-trolled substance

Erin Ashbrook, 26, Paint Lick, public intoxication of controlled substance, third degree trafficking in controlled substance, first degree trafficking in con-trolled substance

Timothy Lykins, 35, Berea, probation violation, non payment of fines, fail-ure to appear

Teresa Douglas, 32, Rich-mond, fourth degree as-sault – domestic violence

Tina Bane, 51, Richmond, second degree trafficking in controlled substance, possession of marijuana, third degree possession of controlled substance

Randall Watkins, 47, Richmond, failure to ap-pear

Brandy Riney, 33, Berea, two counts of failure to ap-pear

Billy Shearer, 44, Berea, violation of conditions of release

Charles Eversole, 21, Richmond, failure to ap-pear

Mildred Kelley, 35, Berea, illegal possession of legend drug, public intoxication of controlled substance

March 17Brandi Cheeks, 26, Crab

Orchard, contempt of courtJaton Morris, 40, Rich-

mond, possession of hand-gun by convicted felon

Hubert Biliter, 58, Rich-mond, fourth degree as-sault – domestic violence

Sheila Foster, 44, Rich-mond, two counts of serv-ing bench warrant for court

Daniel Lamb, 45, Berea, failure to appear

Jessielene Wagers, 42, Manchester, first degree possession of controlled substance

John Adams, 30, Berea, parole violation

Johnny Vickery, 42, Rich-mond, contempt of court

Anthony Lizer, 42, Rich-mond, public alcohol in-toxication

Joshua Hall, 28, Hazard, public intoxication of con-trolled substance, posses-sion of synthetic drugs, buy/possess drug para-phernalia, violation of a Kentucky EPO/DVO, fail-ure to appear

Delroy Gouldbourne, 58, Rock Hill, S.C., non pay-ment of fines

Sarah Hall, 25, Hazard, failure to appear

Scotty Robinson, 43, Richmond, non payment of fines

March 18

Brian Hatcher, 32, Berea, first degree possession of controlled substance – her-oin, parole violation

Ryan Poynter, 22, Berea, operating motor vehicle under the influence of al-cohol or drugs, failure to illuminate head lamps

Jonathan Witt, 30, Rich-mond, serving time

James Hendricks, 30, Richmond, theft by unlaw-ful taking – shoplifting un-der $500

Anthony Begley, 40, Lex-ington, three counts of fail-ure to appear

Kevin Keeney, 31, Georgetown, serving war-rant

Katreena McKenzie, 28, Richmond, operating mo-tor vehicle under the influ-ence of alcohol or drugs, failure of non-owner op-erator to maintain required insurance, license to be in possession

Amanda Skinner, 30, Winchester, theft by decep-tion – include cold checks under $500

Justin Anderson, 29, Winchester, failure to ap-pear

James Mahan, 33, Clay City, non payment of fines, failure to appear

Charlotte Smith, 28, Clay City, contempt of court

Johnny Hacker, 55, Rich-mond, two counts of theft by unlawful taking – from vehicles between $500 and $10,000, second degree criminal mischief, third degree criminal mischief, public intoxication of con-trolled substance

Donald Pancake, 43, Richmond, third degree rape, third degree sodomy


Robin Clubb Ingle, Thomas Lee Ingle to Mark Boatwright, Hazell Hall, Tract 1, Anglewood Acres, $175,500

St. Andrews Place Re-tirement Community, Inc. to Paul Parsons, Unit 3B St. Andrews Place Con-dominiums at 211 Briga-doon Drive in Richmond, $113,500

David Venable, Beulah Venable, Ronnie Johnson, Teresa Johnson to Hershel Williams, Tract, Madison County, $1

Secretary of Housing and Urban Development of Washington, D.C. to Thomas E. White, property near intersection of Hwy 52 and Hwy 21 in Paint Lick, $36,000

Cecelia Begley to Mark S. Hamilton, Naomi M. Day, Naomi M. Hamilton, Tract, Madison County, $48,000

Michael D. Eckler, Sherri L. Eckler to Kevin B. Jones, Angela D. Jones, Tract, Madison County, $95,000

Freddie Ben Davis, Etta Davis to J. Flynn Inc., Lot

20, Burnells Homestead Estates, $24,000

Terry G. Wyatt, Melissa Wyatt to Eddie R. Stepp, Lot 11 Della View Es-tates, subdivision off Ken-tucky Hwy 21 near Berea, $128,500

Ronald A. Willis, Jennifer L. Willis to Kentucky Bank, 124 Commerce Drive, in lieu of foreclosure

David Venable, Beulah Venable, Ronnie Johnson, Teresa Johnson to Justin David Smith, property on Menelaus Pike, five miles north of Berea, $228,600

Deutsche Bank National Trust Company as trust-ee for Securitized Asset Backed Receivables LLC to Alvaro Zamora, Wanda F. Zamora, Tract, Concord Road, $58,000

Travis L. Martin to Jeffrey Wellman, Dawn Wellman, Lot 4, Banyan at Golden-leaf in Richmond, $117,000

John L. Carter, Jr. to Fredrecka Carter, Tract, Madison County, $1

Jeffrey S. Stevens, Ilse L. Dehner to Larry Lamont Leary, 620 Leverton Place in Richmond, $150,000

Teresa M. Conner to RPO LLC, Lot 8, Buffalo Trace Subdivision, $30,000

Lori R. George, Lori R. Miller, Jason George to Wilson Associates Inc., Lot 4, Creekside, $102,500

RBDB LLC to J E E Prop-erties LLC, Lot 2, Meadow-lark Subdivision in Berea, $22,500

Gaylen Forrest Rankin

Property Transfers for Madison County MULCH SALE

$17 PER SCOOP*No Limit whilesupplies last,

Sticks & Stones Landscape SupplyAnnounces It’s Annual Mulch Sale!

March 24th - 26th

We also have a large selection of decorative stoneHome of the Dirt Doctor (bulk Potting Soil)

DELIVERYAVAILABLE!

Sticks & Stones is locally owned & operated.

We are located at :

102 Springcircle Dr., Berea(1st street on right off N. Dogwood)

Phone: (859) 986-2985

Hrs: M-F 8:30-6:00Sat 8:30-5:00

Mulch sale is for dark hardwood only!

LARGEST SCOOP AVAILABLE!

plus tax

I can help you get the coverage you need.People who switched to Allstate saved money and gotmore protection. Which means they’re better prepared forthe mayhem that can happen everywhere. So don’t wait!Call me today.

PAUL REYNOLDS(859) 986 8484REYNOLDS INSURANCE AGENCY, [email protected]

Coverage and savings based on policy features selected and are subject to terms, conditions and availability. Allstate Property and Casualty Insurance Company: Northbrook, IL. © 2010 Allstate Insurance Company


ANGLIN’SBODY SHOP




986-2492

Thursday, March 24, 2016Local News



Foreclosures filed in Madison County Circuit Court between February 29, 2016 - March 18, 2016:

March 1Freedom Mortgage Corporation vs. William M. SmithBlueshine LLC vs. Peggy Sue HowardMarch 4Community Trust Bank Inc. vs. Sarah RhodusJP Morgan Chase Bank National Association vs. Starr LawsonMarch 7Freedom Mortgage Corporation vs. Gary N. KingMarch 8Nationstar Mortgage LLC vs. Reva MaddenMarch 10Kentucky Housing Corporation vs. Jamie D. EstesUrban Financial Off America LLC vs. Patricia CruiseMarch 11JP Morgan Chase Bank vs. Rebecca Lynn MakinJP Morgan Chase Bank vs. David L. CurtisMarch 14Caz Creek Kentucky LLC vs. Betty E. BakerVanderbilt Mortgage and Finance Inc. vs. Jason ReeceMarch 16Wells Fargo Bank vs. Tyler Douglas Isaacs


A rededication of the highway historical mark-ers for the Daniel Boone Trace and Fort Twitty will take place this Friday, March 25 at 2 p.m. at their new location.

The Madison County Historical Society and the Society of Boonesborough are sponsoring the short ceremony for the rededi-cation. The signs are now placed south of Richmond on Golden Leaf Boulevard, near its intersection with Duncannon Lane. The two signs were previously lo-cated on US 25, approxi-mately one mile from the new location, which has been deemed more appro-priate and historically ac-curate.

The public is invited to attend this ceremony. Sev-eral speakers will provide short comments about the history and importance of the events that took place at these locations. In case of inclement weather, the ceremony will be held at

the Arcadian Cove Assist-ed Living Facility located 0.4 miles north on Golden Leaf Boulevard. Further information is available from Tom Black, president of the Madison County Historical Society, at 582-6963.

The two markers being commemorated were in-stalled under the auspices of the Kentucky Historical Society’s historical marker program. The Boone Trace marker was originally placed in 1972 at the I-75 rest stop and subsequently moved to the Fort Estill hill on US 25 when the rest stop was demolished. The Fort Twitty marker had re-sided on the Fort Estill hill since its creation in about 1955.

The Madison County Historical Society and the Society of Boonesborough sponsored refurbishment of the Fort Twitty marker with its highly weathered condition, and upon its re-turn the renewed marker

was installed in its current location. The reconstruc-tion of Duncannon Lane and the creation of Golden Leaf Boulevard provided a new, highly visible site that was directly accessible to Fort Twitty. Addition-ally, it was on Boone Trace, so that marker was also moved. Recent research has confirmed that Boone Trace ran up Harts Fork of Silver Creek, through the southern portion of the Richmond Industrial Park and then directly to Fort Twitty through this site.

Boone Trace is one of the most historically im-portant trails in America. Blazed by Daniel Boone and his party of axmen in March of 1775, it made en-try into the Western lands beyond the Appalachian Mountains possible.

At the time of this trail opening, the country north of the Ohio River was in-habited by Native Ameri-cans who considered Kentucky their exclusive

hunting territory. Intru-sions by white pioneers were not acceptable, and one demonstration of their resistance occurred on the early morning of March 25, 1775, just north of these markers with a pre-dawn attack on Boone’s party. Captain William Twitty and his slave, Sam, were killed. Felix Walker was wounded, but able to move on to the Kentucky River within a few days. His diary provides the de-tails.

Twitty and Sam were buried at the site of the at-tack, which became known as Fort Twitty or the “Little Fort”, commemorating the hasty erection of a small stockade used for protec-tion until the party moved out. The site is now owned by the Boonesborough Chapter of the D. A. R., which also erected a small stone monument in 1937.

Rededication of Boone Trace, Fort Twitty Markers

ABSOLUTE ONLINE ESTATE

AUCTIONEER: SAM FORD www.fordbrothersinc.com

Somerset, KY Mt. Vernon, KY London, KY 606-679-2212 606-256-4545 606-878-7111

800-435-5454


In order to settle the estate of the late Geneva Botkin, her daughters, Ms. Becky Duerson & Ms. Marieta Eaton, have authorized our firm to sell all of her personal property at absolute high dollar.

Items available include:Pennsylvania House Cherry hutch ~ Pennsylvania House Cherry table & chairs ~ Cherry tea cart serving tray ~ loveseats ~ couches ~ coffee & end tables ~ recliners ~ living room chairs ~ dry sink/server ~ 3 piece Cherry bedroom suite ~ 4 piece Maple bedroom suite ~ Crosley stereo ~ Voice of Music stereo ~ bedroom sets ~ bakers rack ~ woven baskets ~ desks ~ mirrors ~ vases ~ numerous lamps ~ framed prints ~ wall hangings ~ microwave ~ Bybee dishes ~ pressure cookers ~ candlesticks ~ linens ~ towels ~ plant stands ~ Quasar T.V. ~ bar stools ~ various glassware ~ picnic table ~ decorative plates ~ China sets ~ and much, much more!

This is only a partial list of what will be offered online. We encourage you to log on to www.fordbrothersinc.com to view a full list of items with pictures.PREVIEW DATES: Friday, March 25th & Thursday, March 31st from 3-6 p.m. at 119 Holly Hill Dr. in Berea.PICKUP DATE: Friday, April 1st from 1-6 p.m. at 119 Holly Hill Dr. in Berea.

BUYER’S PREMIUM: A 10% Buyer’s Premium will added to the winning bid to determine the final sales price.TERMS: Payment in full due at time of pickup, in the form of cash, check, MasterCard or Visa with an additional processing fee.

Announcements made day of sale take precedence over printed material.

of The Late Geneva Botkin’sPersonal Property, Antiques & Glassware

Bid Online Now!Sale Ends Thursday, March 31, 2016 at 6 p.m.




08:00—08:45


200 Harrison Road



Information






Registration Form



Zip Code:______________







Date: ___________________




to W & A Investments LLC, two lots on Madison Avenue and one begins at corner of Kimberlain and Anderson lot, $105,000

Peoples Bank and Trust Company of Madison County to Eagles Way LLC, 2017 Merchant Drive in Richmond, $275,000

Butch Coyle, Esmer Coyle, Janet Coyle to Tim-othy Ross Adams, Tonya Gaye Adams, Tract, Madi-son County, $210,000

Butch Coyle, Esmer Coyle, Janet Coyle to A T Grant Holding Co LLC, Tracts near Caleast, $130,000

Michael Napier, Danita Napier to Paul E. Groves III, Micah Sanning, 1008 Palmetto Drive in Rich-mond, $297,500

Barry Gibson, trustee, Jennie Rayburn Testamen-tary Trust, Diana Gibson to Barry Gibson, Diana Gib-son, 2921 Lancaster Road in Richmond, $2,000

Burl Johnson, Julia Schanzle to Ben Wilson, Martha Wilson, 1893 Tates Creek Road in Richmond,

$150,000Cynthia L. Fetty to James

E. O’Bryan, Ladonna O’Bryan, 145 Oak Meadow Drive in Berea, $223,000

Jack R. Green, Bridget Carroll to Jackie Pullum, 40 and 30 Crawford Street in Berea, $55,553,35

Rick Horn, Tina Horn to Jessica Pollard, Timothy Miesmer, Lot 8, Double D Meadows Subdivision in Richmond, $158,000

Emogene M. Hogg Hart-man, trustee, Emogene M. Hogg Trust, James Hartman to Edd Doug-las Hogg, property lying on the headwaters of Red

Lick Creek, no monetary consideration, but rather as a gift

Emogene M. Hogg Hart-man, trustee, Emogene M. Hogg Trust, James Hart-man to William Brady Hogg, Lots, Jefferson Vil-lage Subdivision, no mon-etary consideration, but gift from parent to child

James Christopher Cobb, Shella C. Cobb to Buck-master Enterprises 401 K Plan, Inc., Tract, Madison

County, $100,000Rupert Elmer White to

Erik Scott Dunlap, Leslie Ann Dunlap, Lot 66, Mead-ow Subdivision, $324,900

Linda Eleanor Wells Es-tate to Cheryl Duarte, Lot 8, Tates Creek Estates Sub-division near Richmond, $126,000

Robert R. Boardman, Karen H. Boardman to Peter Nathaniel, Megan Nathaniel, Tract, Madison County, $420,000

GC/WBR LLC, GC/BOR LLC, GC/EW LLC, GC/MRE LLC to MACQ Kentucky II LLC, Tract 1 on Grand Campus Prop-erty, $40,125,000

MACQ Kentucky II LLC to Commonwealth of Ken-tucky Eastern Kentucky University, Tract 1, Grant Campus Property, Master lease and facilities lease be-tween grantor and grantee

March 11Nora Young vs. Kevin L. KeeneyStephanie Mosley vs. Jacob MosleyMarch 14Barry Clemmons vs. Janel ClemmonsAmanda Baumgardner vs. Jared Daniel HardingMarch 15Bryan Holt vs. Tiffany HoltCabinet for Christopher M. Wright vs. Candi L. WrightMarch 16Sarah L. Elkins vs. Jonathan L. ElkinsMarch 17Danny McGlothen vs. Barbara BolinTommy Leland vs. Britany RichardsonMarch 18Rachel Ann Cook vs. Dallas Quinton CookJanice Abner vs. Brian AbnerDaniel G. Baker vs. Cindy F. Baker

Domestic and Family cases filed in Madison Co. Circuit Court between March 11, 2016 to March 18,

2016: Cases may include divorce, child custody or support.


feel welcome, so she plans to serve meals for gluten-free, vegan, and other spe-cial dietary needs.

Isaacs is from Jackson County, but felt that peo-ple in Berea would appre-ciate the healthier options she plans to serve. While doing a major renovation of the historic building, she is also honoring its his-tory, preserving the 15’ tin ceilings and wood floor-ing There will also be res-taurant displays, sharing about the building’s past.

At the end of May, the

former Wan Pen building near Walmart will become Yamato Japanese Steak-house. The fine dining menu will feature hiba-chi grilled meat and veg-etables, a wide variety of sushi, and bento box meal combinations. Those who wish can also have Saki and wine.

Owner David Dong from Georgia plans to open his 7th restaurant in Berea because there is no other Japanese food restaurant in the area, and he found this an ideal location.

Noodle Nirvana, coming in early July to 315 Chest-nut Street, is the brainchild of Mae Suramek. Accord-ing to Suramek, it will be

“a fast, casual build-your-own noodle bowl eatery dedicated to creating epic, fresh noodle bowls and uplifting local communi-ties.” The sauce menu will include house special cur-ry and spicy peanut and the noodle selections will include zoodles, i.e., pasta made from zucchini. Pro-tein choices will include beef, chicken, and tofu, and Kentucky craft beers will also be offered.

Besides offering her comfort food to Berea, Sur-amek also wants to create a business model that im-pacts non-profits in a big way. That inspiration is from her years of working with nonprofits and seeing

how a business could re-ally make a difference. She will choose one nonprofit per year and offer them an in-store display, daily profits once a month, host-ing for a yearly fundraiser, and more.

In addition to these new restaurants, the City of Berea is working to move a restaurant into the train depot, because they be-lieve it is an ideal restau-rant spot, though no plans are final yet.

Thanks to these five en-trepreneurs, the local food scene will become more vibrant and unique, pro-viding jobs and serving the stomachs of locals and visitors alike.

RESTAURANTCONTINUED FROM B2



The Berea CitizenAlways Local,

Always There

Ground was broken in March 1976 for two mil-lion dollar construction projects at Berea College -- an addition to the alumni building, and an addition to the art building.

Winners of the DAR es-say contest were honored at the club’s March meet-ing. Stephen Robinson of eighth grade at Berea Community won first place. Other winners were John Norman Miller, Scott Hallam, Jeff Brewer, Vicki

Hayes, and Sharon Baker. Jeff Brewer from Silver Creek School was also pre-sented with a medal for his first place essay at the meeting.

Emma West Thompson was the hostess for the meeting, and she was as-sisted by Mrs. Luther Am-brose. Guests at the meet-ing included Dr. Charlotte Ludlum, Faith Birznieks, Mrs. Robert Pollar, and Mrs. Berton Mullins.

Students from Berea on

the Honor List at Berea College were Melanie Ab-bot, Ann Adams, John Ba-cic, Robin Bobbitt, Nena Byrd, Cora Crandall, Deb-bie Duckwall, Sheila Go-odrich, Katie Heckman, Priscilla Kiteck, George Loze, Jesse Maupin, Alice McLain, Linda Mullins, Martha Nelson, Lisa Pen-nington, Betty Poynter, Stephen Ramsay, Steve Toussaint, and Julia Weath-erford.

In March 1976, Berea Community School students representing different sports presented Mayor Hensley with a comple-mentary card for membership to the Boosters, when he proclaimed Athletic Boosters Week. Standing, left to right, are Kim Cornelison from girl’s basketball, Angela Taylor from girl’s track, Marc Cox from golf, Steve Carter from foot-ball, and Chuck Mastin from track; seated are Ellen Dernovshek from the cheerleading squad, Donnie Atkins from baseball, Mayor Hensley, John Ramsay from basketball, and Burton LeGear from soccer.


Good Friday ServiceMarch 25th 7pm Join us as we remember

the Lord Jesus as he paid in full man’s sin debt.

Guest speakers, William Dooley, Bro. Ken Felty ofLiberty Avenue Baptist Church

Special Singing

Join us Back at Bethel for the annual

“Through a tree we were made debtors to God; so through a tree we have our debt canceled.”

— Irenaeus

Bethel Baptist Church

Pastor, Kenny Davis Jr.

859 986-7341Sharing an unchanging Christ with an ever changing world.

Hebrews 13:8 Jesus Christ , the same yesterday, today and forever.

Easter Egg Hunt and Children’s Easter Celebration

Saturday, March 26th 2pmSaturday, March 26th 2pm

Brushy Fork Park

Sunday, April 3rd 11:00 am serviceSunday, April 3rd 11:00 am serviceDinner to follow @ Silver Creek Cafeteria

Easter Sunday March 27 thSunrise Breakfast and Service 6:00 am

Resurrection celebration 11:00 amSpecial Testimony Service 7:00 pm

Homecoming Celebration

Berea Drug has served Berea and the surrounding area for almost 40 years.We are family owned/operated & remain committed to our customers with fast,

friendly service. Stop in today & see what we can do for you!For more than 40 years Berea Drug has

served our customers with a level of compassion & caring that’s unmatched.

If a family oriented Pharmacy is what you’re seeking, please consider

Berea Drug.


www.BereaDrug.com

Walk-ins welcomeor call ahead.

Memorial Hwy Berea

Pilot Knob Missionary Baptist ChurchPastor Greg Lakes

8091 Battlefield 859-985-9342

CELEBRATING 150 YEARS Join us for an early service at Pilot Knob Cemetery

on

Followed at 10:45AM by Easter Cantata and Service.

Easter Sunday, March 27th at 8:00AM followed by breakfast and fellowship in the church

fellowship hall.

Tommy Parson from Berea, Kentucky’s Spe-cial Olympic Athlete of the Year, was honored at the Kentucky Senate on Wednesday, March 2.

Parson received an hon-orary citation and stand-ing ovation from the Ken-tucky Senate during the 2016 General Assembly. The honorary citation was presented by Senator Jared Carpenter from Madison County.

Tommy’s mother, Ge-nene Parson, said, “It was so touching to see all of the senators supporting our son. We are so appreciative to Senator Jared Carpenter for making this wonderful experience possible. Tom-my was on cloud 9.”

Madison County Spe-cial Olympics is so grate-ful for everyone who has made his, “Athlete of the Year” experience wonder-ful. Tommy has received incredible support from his community and friends and truly enjoyed his expe-rience.

Parson Honored at Kentucky Senate

Local News

THURSDAYMarch 31,

2016Vol. 116, Issue 43


Inside





Our Staff

Teresa Scenters,

Publisher

Beth Myers,

Editor

Kim Kobersmith,

Reporters

Keeley Johnson,


Sheila Johnson,

Advertising

Timothy Pack,

Graphic Design

50¢ Newsstand

Plac

e m

ail l

abel

her

e

Contact Us



Ph:859-986-0959Fax: 859-986-0960


B1



City council reviews final plans for new city hall, fire, and

police station.

Photo SubmittedStudents from Berea College perform in Kinetic Expressions in 2015 (above), the annual concert the college gives on modern dance. A free, shorter performance will be offered on Saturday, April 9 at 3 p.m. for families that will include the more colorful, dramatic dances.

Berea College Offers Free, Family Friendly Modern Dance Matinee


In the past several weeks, the Berea City Council has heard presentations from Kentucky Utilities (KU), KyMEA (Kentucky Mu-nicipal Energy Agency), AMP-Ohio, and their own energy consultants, but they are still far from mak-ing a decision about pow-er purchasing, or joining KyMEA.

Berea City Administra-tor Randy Stone will be setting up a session in the next couple of weeks for city council members to discuss all the power purchase options, and he expects the discussion to be “interesting.” Council members have been dig-ging through the energy issue for months now, and one thing they all agree on is that it is one of the most complicated topics they have ever had to tackle.

Council member Jerry Little has been the most vo-cal against joining KyMEA, a newly formed govern-ment agency of ten munic-ipal utilities in Kentucky that have joined forces to negotiate better wholesale electric costs. Most of the municipal electric utilities, which purchased whole-sale electric power from KU for decades, decided to cancel their contracts with KU last year because of terms they found unfavor-able that were later over-turned.

Initially, the Berea City Council was supportive of joining KyMEA, but they backed off when they read through the interlo-cal agreement. Since then, the council has solicited wholesale electric bids through their consultants, and received approximate-


Families will have the opportunity to attend a free modern dance per-formance at Berea Col-lege next weekend, when Kinetic Expressions 2016 holds a matinee on Satur-day, April 9 at 3 p.m. in the Seabury Gym.

This is the second year that Berea College has of-fered Kinetic Expressions at a free matinee for fami-lies, and college staff are hoping to bring in a lot of children from the commu-nity for the performance.

“It’s a great opportu-nity for kids to see mod-ern dance,” Sarah Downs said from the Berea Col-lege Dance Program. “We made the matinee an hour, because that seems like

the amount of time kids are able to sit for a perfor-mance. We’ve chosen the most engaging dances, ones that are more colorful and dramatic, with bodies being thrown in the air, for the matinee. We want lots of kids and families to at-tend.”

A teen dance class will also be performing at the matinee, with dancers from both Berea Community and Madison Southern. At the end of the afternoon performance, children will be invited to the stage to dance to the song, Happy, with the whole cast. A do-nation of $5 is suggested. Downs said they would use those funds to help with costumes for the fol-lowing year.

SEE DANCE, PAGE A5SEE ENERGY, PAGE 5

Photos by Beth Myers/The CitizenAnd the Teachers Get the Pie! Students from Shannon Johnson Elementary got to throw pies at their teachers last Friday, as the culmination of a fundraiser for Hospice Care Plus. In every grade, the teacher of the class that raised the most money for Hospice was rewarded by getting a whip cream pie thrown in his or her face by the child who raised the most money from the class. It was a raucous afternoon for the elementary school, as students stood up to scream and cheer as they saw their favorite teachers taken down by pie.


The Lunch on the Lawn event this Friday at the courthouse in Richmond will not only be an event to honor Child Abuse Awareness Month, but also an opportunity to recruit for a revitalized CASA (Court Appointed Special Advocates).

CASA, a program that partners volunteer ad-vocates with abused or neglected children in the judicial system, has been languishing in Madison County for some time. Judge Jeffery Walson first brought the program to the county 18 years ago, and single-handedly got it started. It was a strong organization for many years, but community in-

volvement has been slow-ly decreasing.

“The reason for failure is it didn’t have grass-roots support the last several years,” Bob Soffel said, who has been work-ing as the interim director since November. “There was a real lack of commu-nity buy-in.”

Soffel agreed to volun-teer as the executive di-rector for 120 days, to see if it was feasible to keep Madison County CASA going. He took a hiatus from his business, Critical Energy Solutions, and has spent the last four months talking to everyone he could in the community. People responded very positively, Soffel report-ed, and he found tremen-

CASA Re-Energizes to Serve County’s Abused Children

City Still Split on Energy

Decision

Photo by Beth Myers/The Citizen

On Your Mark, Get Set, Go Get Eggs!Families from Berea came out for the 79th Annual Easter Egg Hunt Saturday at the Berea Expansion Park. Lanes were set up for the different ages on the field, up to 10 years old.

SEE CASA, PAGE A5






A2 The Berea Citizen Thursday, March 31, 2016Obituaries/Local News

Obituaries from local funeral homes are printed free in the Berea Citizen as a courtesy to our readers.



(859) 986-8416 • 1-800-307-0463



Owner


Owner



Hazel Alexander Chrisman, 69, of Berea, died suddenly Thursday, March 24, 2016 at St. Joseph Berea of an apparent heart attack. She was a Kerby Knob native, born May 21, 1946.

Hazel was the daughter of the late Thomas and Flora Clem-mons Alexander, Sr. She was a homemaker, and member of Pilot Knob Missionary Baptist Church. She was a resident of the Berea area most of her life.

Survivors include her two children, David (Re-becca) Chrisman and Melissa (Jeffrey) Abrams; one sister, Shirley (Glendon) Combs; and six grandchil-dren, Zachary (Courtney) Phillips, Matthew Phillips, Samuel Chrisman, Amanda Abrams, Megan Abrams and Jesse Abrams. In addition to her parents, she was preceded in death by three brothers, Otis Alexander, Thomas Alexander, Jr., and Wilbert Alexander.

The funeral service was at 11 a.m. on Monday, March 28, 2016 at Pilot Knob Missionary Baptist Church with Pastor Greg Lakes officiating. Burial followed in Berea Cemetery.

Pallbearers were David Chrisman, Jeffrey Abrams, James Seals, Dale Croucher, Darrell Combs and Neal Broadus. Honorary pallbearers were her grandchil-dren, deacons of the church, members of the Ladies Sunday School Class, Joyce Seals, Jean Croucher, Jea-nette Combs, Bethel Parker, Shirley Deaton, Bonnie Kendrick, Darlene Haney, Kim Jones, and her nieces, nephews, and cousins.

Doris Robinson Rominger

Hazel Alexander Chrisman

Martha Lee Witt Lewis passed away on Saturday, March 26, 2016 at her home in Berea. She was born on September 11, 1931, in Harlan to Werley Emerson and Dora Belle Templeton Witt.

Mrs. Lewis was a housewife, and member of the Berea Baptist Church.

Survivors include her son, Stephen Harold Lewis, and her daughter, Janet Lee Lewis; three grandchil-dren, Jeremy Daniel Lewis, Jonathon Harold Lew-is, and Jessica (Charles) Rachel Bradley; two great grandchildren, Charles (Trey) David Bradley III and Anna Elizabeth Hope Lewis, all of Kentucky; and a brother, Myron (Rotraud) Witt of Petaluma, Calif. She was preceded in death by her husband of 49 years, Harold Russell Lewis; a daughter, Joan Karen Lewis; and a grandson, Joshua Stephen Lewis. Her brothers, Carl, John, Norris, Alfred, Colin and Dwight, and her sisters, Dolores Pettinger, Eileen Smith, Nadine Eplee and Melba Richwine preceded her as well.

Funeral services for Mrs. Lewis were at 1 p.m. on Tuesday at the Davis & Powell Funeral Home with Rev. Kevin Slemp officiating. Burial followed in the Berea Cemetery.

Davis & Powell Funeral Home is in charge of the ar-rangements. www.davisandpowellfuneralhome.com

Martha Lee Witt Lewis

Doris Robinson Rominger, 98, died at her home in Berea on Friday, March 25, 2016. She was born in Gar-rard County in 1917.

Doris was preceded in death by her husband, Don Rominger, with whom she owned Rominger Funeral Home; by her parents, Sherman M. and Flora Shock-ley Robinson; and nine brothers and sisters. She is survived by her son, Paul Rominger of Berea, and her grandson, Sherman (Becca) Rominger of Greenville, S.C.

Doris was a member of First Christian Church. She was a bookkeeper, and served for many years as trea-surer of the Berea Ministerial Association.

Her funeral service took place at 2 p.m. on Mon-day, March 28, 2016 at Reppert Funeral Home with Dr. Glenn Birkett officiating. Burial followed in Berea Cemetery.

The fifth annual Audible Easter Egg Hunt took place last Saturday at the Glades Christian Church in Berea.

This annual event was co-sponsored by the Berea Lions Club and Families Advocating For The Blind (F.A.B.). Mem-bers from both organizations, as well as parents and chil-dren, took part in the event.

Special Easter Egg shaped devices, equipped with talk-ing electronics, allow the vi-

sually impaired children to locate the eggs. Next to the “talking Easter Eggs” are other plastic eggs containing candy to reward the find.

Above, children, parents, and members of the Berea Lions and Families Advocat-ing For The Blind (F.A.B.) gather before the hunt.

Left, Jaden Lilly, with his mom Laura Lilly, search for the hidden “talking Easter Eggs.” Laura is a teacher with the Madison County Visually Impaired program.

Audible Egg Hunt Takes Place at Glades

Christian Church

A new location for mas-sage and yoga opened in Berea in March, when An-dri Kukas received a $5,000 business development grant from the United Way.

Kukas used the grant to renovate a portion of her home into a separate work space, Thrive Stu-dios, where she hosts other practitioners and operates her business, Healing Mas-sage. She is a licensed mas-sage therapist and a regis-tered yoga teacher, and has a BS in ecology.

“I am a holistic health practitioner,” Kukas said. “I have had many clients recover from simple inju-ries, aches and stiffness, but also more serious con-ditions such as chronic

headaches, sciatica, frozen shoulders, whiplash, even anxiety attacks and sleep-lessness.”

The main techniques Ku-kas uses are craniosacral therapy and myofascial release, also called deep tissue. This work can all be done full clothed.

Kukas said the two main camps for massage therapy are restorative and relax-ation. She does both.

“I can do a swedish relax-ation oil massage, or preg-nancy massage, reiki, or thai massage too,” Kukas said.

A client of Kukas’, Joe White, said, “I had been suffering on and again for years with sciatica...I had been experiencing pain for more than six months con-sistently...In only a couple of visits, I was much im-proved. In a season of vis-its, I felt great. Andri not only provided corrective massage, but also gave me advice and guidance for stretching, sitting and standing posture and other corrective measures. I feel so much better that I have been able to return to labo-rious work.”

Thrive Studios was

previously located in Churchill’s, and before that, on Chestnut Street. The business moved to its present location in Berea, 97 Taylor Drive, three minutes from I-75. This is a mixed use facility of Kukas’s resi-dence and a separate work studio, so visits to the site are by appointment only.

“I made a smart business move by eliminating rent, and am simultaneously of-fering a sweet little oasis to my clients that provides a serene and optimal healing environment overlooking a pond,.the pinnacles, and soaring birds,” Kukas said.

Kukas also does home visits.

“I travel weekly to work on a client who has a trau-matic brain injury because it would be so much work to get him to me,” she said.

Beginner Slow Flow Yoga classes at Thrive Studios are Tuesday, Wednesday, and Thursday at 9:30 a.m. and 7:30 p.m. Detailed in-structions and small classes allow for individual atten-tion (if desired) as to avoid injury later if you develop a more rigorous practice. At-tention is given to staying within your personal limi-

tations. Students learn correct

body mechanics, stretch-ing, strengthening, bal-ance, breathing, and culti-vate inner peace through meditation. Starting in May, Thrive Studios will be hosting intermediate, power, and laughter at the same times on Mondays and Fridays.

Prices are $30/month for one yoga session/week, or $45/month for two ses-sions/week and a person may take one make up les-son per month if arranged in advance. It is $10/drop-in class. Massage therapy is $50/hour. Discounts are offered for package pur-chases.

Thrive accepts cash, check, or credit. People are invited to like Thrive Stu-dios on Facebook or email [email protected] to stay informed on work-shops, discounts, mother’s day specials, and a Grand Opening celebration. April classes start next week. Di-rect questions, register for classes, or schedule a mas-sage by calling or texting 859-582-6295.

Massage and Yoga Studio Opens in New Berea Location


Stolen Property Arrest• On March 22, officers were called to Marcellus Drive because of suspi-cious activity. They lo-cated a woman pushing a trashcan that contained various items that turned out to be stolen. Officers arrested Wendy Smith, 42, of Berea and charged her with receiving stolen property under $500.

Drug Arrests• On March 24, a traffic stop was conducted on Slate Lick Road for a mi-nor traffic violation. After speaking with the driver, two oxycodone tablets were located inside of the vehicle near the driver and a passenger. Officers arrested Grant Graham, 34, of Georgetown and Kayla Young, 24, of Berea. They were both charged with first degree posses-

sion of controlled sub-stance. Graham was also charged with several traf-fic offenses.

Public Intoxication• On March 28, offi-cers were called to Berea Health Care Center be-cause of a suspicious person. The person was located and seemed con-fused and stated that she did not know why she was there. She was also unsteady on her feet and had slurred speech. Officers arrested Andrea Isaacs, 26, of McKee and charged her with public intoxication. • On March 28, officers ar-rested Roscoe Abner, 34, of Richmond. An investiga-tion revealed that he sold several rings to a pawn shop in Richmond. The victim reported that the rings were stolen from her home, and Abner had been doing carpentry work for her. He was charged with receiving stolen property under $10,000.


Berea College Recognized For Strong Graduation Rates of Low-Resource Students



ANGLIN’SBODY SHOP




986-2492

GOLDBERG & OSBORNE1-800-THE-EAGLE(1-800-843-3245)

www.1800theeagle.com

915 W. Camelback Rd.Phoenix, AZ 85013

Open 7 Days

a Week

BABY POWDEROR OTHER TALCUM POWDER LINKED TO

Long-term use of baby/talcum powder is linked to ovarian cancer. If you or a loved one suffered from ovarian cancer after using Johnson’s Baby Powder, Shower to Shower or other talcum powder, you may be entitled to substantial compensation. Call us at 1-800-THE-EAGLE now. No fees or costs until your case is settled or won. We practice law only in Arizona,Arizona, but associate with lawyers throughout the U.S.

OVARIAN CANCER


Regular Inspections With No Follow-Up Due ScoreSmitty’s Southern Style BBQ, 474 E. Irvine St., Richmond 97%Hissho Sushi @ Meijer’s, 2013 Lantern Ridge Dr., Richmond 100%Richmond Raceway, 328 Greens Crossing, Richmond 97%Kirksville Elementary Cafeteria, 2399 Lancaster Rd., Richmond 100%Richmond Head Start, 301 Bellevue Dr., Richmond 98%

Regular Inspections With Follow-Up Due ScoreFour Sisters Soap & Tea Emporium, 106 S. 3rd St., Richmond 94% *Sanitizer concentration at dishwashing too high Follow-Up Inspections With No Follow-Up Due ScoreMain Street Café, 110 Main St., Berea 98%


The Berea CitizenAlways Local,

Always There

On March 24, Berea Col-lege President Lyle Roelofs attended a meeting hosted by the U.S. Department of Education focused on highlighting institutions across the country that are making significant strides in increasing graduation rates among students eli-gible for Pell Grants.

“For students from low- and moderate-income fam-ilies, a college degree is the surest path to the middle class in our country,” said U.S. Secretary of Education John B. King, Jr. “I applaud the colleges and universi-ties that have taken mea-surable steps to open up this pathway and make it a successful one for students from all backgrounds. But we need these types of ef-forts to become the rule and not the exception.”

King continued, “Since the beginning of his ad-ministration, President Obama has worked to en-sure more Americans have the opportunity to get a quality, affordable higher education, with promising results – more students are

graduating from college than ever before. But many American families still feel that college may be out of reach for their children.”

In a newly published report titled, Fulfilling the Promise, Serving the Need, Advancing College Oppor-tunity for Low-Income Stu-dents, the U.S. Department of Education says colleges and universities have a responsibility to expand access to all students and offer targeted support for low-income students. The report is also a call to ac-tion for institutions with significant gaps between completion rates for Pell Grant recipients and over-all completion rates, as well as institutions that have positive outcomes but enroll too few low-income students. The Pell report is available online at http://www2.ed.gov/about/overview/focus/advancing-college-oppor-tunity.pdf.

Roelofs said, “Consider-ing the ongoing national discussion about afford-ability and access, we at

Berea College find it es-pecially gratifying to be recognized as a leader in serving the public good by educating talented, low-income students who become service-oriented leaders in Appalachia and beyond.”

Roelofs also stated, “Na-tionally, fewer than 13 per-cent of low-income college students graduate by the time they are 24. At Berea, we graduate five times as many.”

Ted Mitchell, U.S. Under Secretary of Education, commented, “For us to thrive as a diverse democ-racy and for individuals to achieve their dreams of success, higher education must fulfill its promise of providing opportunity to all students, regardless of their race, gender or in-come level.”

Mitchell continued, say-ing, “That opportunity means access, but getting into college is not enough. It’s getting in and get-ting through that matters. There are remarkable insti-tutions around the country

succeeding at making ac-cess and success a reality for low-income students. We need to learn from their leadership and spread the word about practices that work.”

The Department of Ed-ucation conference with college presidents, trust-ees and campus leaders from across the nation was held to discuss ongoing work. Among those at-tending were several who represented colleges and universities included in the report. The event spot-lighted the promising and proven practices devel-oped by these institutions to advance success for low-income students, and encourage broader conver-sations among the field to accelerate this work.

Brilliantly colored fabrics will be-come ‘fins and feathers’ as textile artist Marilyn Foulke, of Louisville, demonstrates how she captures a variety of fish and bird species in her quilts on Saturday, April 9, from 10:30 a.m. to 3:30 p.m. at the Ken-

tucky Artisan Center at Berea. For her creations, Foulke uses a

combination of piecing, raw edge ap-pliqué and machine quilting.

A native Louisvillian, Foulke has been interested in fiber and fabrics from an early age. Her love of hand

and machine sewing began with grade school projects, and she has always been interested in color and design. In 1997, she began creating quilts, wall art and wearable art. Her quilt making is informed by her ca-reer as a mathematics teacher for over 30 years, and her love of geom-etry, symmetry, logic and balance.

“I am a self-taught quilter,” Foulke said. “My work is not constrained by ‘rules’ or patterns, and I enjoy creat-ing outside the box. I love to experi-ment with unusual embellishments and materials.”

In Foulke’s quilted wall hangings, she uses fine quality cottons and silk, sometimes hand dyeing them to get the color she wants. Most of her pieces are one-of-a-kind and her fish and bird-themed quilts are all based upon observation, drawings and photographs taken during her travels.

Textile Artist to Demonstrate at Artisan Center





the


Berea


- Galatians 6:9






or change any submitted information. © 2016 Berea Publishing, Inc. Opinions expressed on this page are those of the contributors and are not

necessarily shared by the owners and management of this newspaper.

Letters from

BereaBeth Myers

Editor

ScenterStage

Teresa Scenters,Publisher


From our readers

What Do You Know? Can anyone identify the men standing with the train in the above

photo? Or share any other information regarding the train or what prompted the photograph?


Dear Editor,

Mrs. Elkins, fifth grade teacher from long ago, told about an event that happened in her neighbor-hood when she was a girl. A fire had started in some-one’s house and the poor homeowner went around knocking out the windows and opening the doors, hoping the wind might blow it out. Of course, the fresh air only led to hotter, more destructive flames

and destroyed the house long before the firefighters could contain it.

Without a doubt, the rebel flag is a symbol that stirs up a lot of unwanted emotions. Unfortunately, the fires of this issue have expanded due to all the winds blown onto it. It could have/should have been handled differently. Individuals and groups have needlessly been scorched by the heat.

Now, the socially-obser-

vant people of our commu-nity of 12,000 +/- see a reb-el flag and think, “there’s a redneck racist who is looking for trouble”. This stereotyping is inaccurate and damaging. There must be a better way.

Mike WallacePaint Lick

Stereotyping of rebel flag inaccurate, damaging

My husband is the king of office pranks, and April 1 is his favorite time of the year.

He has pre-warned his office mates about Friday, in order to build the an-ticipatory dread in their hearts. His pranks are both simplistic and sophisti-cated, and he has the tech-nical knowledge to make someone’s life quite mis-erable. At various jobs be-fore, his female co-workers would find Chippendale dancers on their computer wallpaper, or office equip-ment mysteriously mal-functioning.

At my previous job, he delighted in pranking one particular co-worker of mine. He once changed her wallpaper to a photo of the

Orcs from Lord of the Rings, and everytime it was boot-ed up a fart sound was ac-tivated. He also put a dab of super glue at the end of all her pens, switched her desk drawers, and once even snatched her keys so he could park her car smack dab in the grassy area in the middle of the parking lot.

I usually found out about these pranks when he would run into my of-fice at lunchtime, hide be-hind the door, and she fol-lowed, shrieking, “BETH! I’M GONNA KILL HIM!” And to answer the inevi-table question, yes, it was an unusually tolerant type of office environment.

His plans for this Friday (this will not be a spoiler, since he works out of coun-ty) include arriving very early so he can gather all the staplers in the office to put on his desk, place An-noy-a-Trons in the front of-fice, and place the life-size Darth Vader that I bought him for his birthday in the women’s bathroom to tell them to “release their an-ger” whenever the door opens. He purchased these Annoy-a-Trons -- small cir-cular devices that emit an-noying sounds at random intervals -- specifically for Friday.

With me, he’s not quite so sophisticated. His fa-vorite prank has always been the drive-away-right-when-she’s-about-to-open-the-passenger-door-of-the-car, circle around, return, repeat. It just never quit being awesomely fun-ny to him. It only stopped when my children got old enough to start scream-ing at him because they thought he was leaving Mommy behind.

I have never been his equal at these pranks. It’s hard for me to think them up, and when I do, they of-ten seem to go too far, over that vague, invisible line between humorous and cruel. For example, dur-ing college I snuck into his apartment and put all his stuffed animals in nooses that hung from the ceiling of his bedroom. They were hanging there, basically committing group suicide, when he came back from class. I thought it was hi-larious, but he called, ex-tremely upset with me, repeating the phrase that, “you just don’t do that to stuffed animals.” It took him weeks to forgive me for that. I have asked people about that prank over the years, and they all agreed that hanging stuffed animals by their

necks had definitely gone too far. Some people were really shocked that I tres-passed on such sacred ground. For whatever rea-son, it was clear that I just didn’t have an internal ra-dar on what was appropri-ate or acceptable in prank world.

So for this year’s April Fools Day, I have decided to recuit some help. My two sons quickly agreed to work with me on Op-eration Prank Daddy this Friday. I have also put that tool of all things informa-tional -- the Internet -- to use with a google, “best April Fools pranks.” I know it lacks integrity to have to google for pranks, but frankly, I needed the help. I did personally come up with the idea of dress-ing his penguin pillow pet in his underwear, which evidently is fine to do to a stuffed animal as long as it does not lead to asphyxi-ation. And of course, I’ll have to keep him from reading the newspaper for a couple of days.

Successfully pranking my husband is a small am-bition certainly, but of such small victories are great lives built upon. So Merry April Fools Day to all, and to all a good night.

Often, despite the scrip-ture passage that appears every week on this page, I do grow weary.

The constant bickering that seems to be ever pres-ent in Berea wears me out. I question why it seems that any and every issue to rear its head in this town has to become ri-diculously contentious.In my opinion, many (if not most) of these things are manufactured by a few people out looking for a cause or reason to be of-fended.

Why do we not seem to be concentrating on issues that are much more rel-evant to the overall well being of Berea? Drugs have taken over, but we don’t see any demonstra-tions in the streets de-manding that something be done about them.

The effects of addiction touch us all, if not through our own families then among our neighbors and friends.

Instead of belligerence over some chicken or red/blue shirt or flag why not use all that energy to elicit paths to healing our com-munity of the ill effects of true human tragedy?

There is so much suf-fering from drug abuse and the crime and mis-ery that surrounds it. It’s overwhelming and so is the number of uncared for and neglected, often times hungry children in Berea. But those horrors just don’t seem to be on the radar of causes to be championed.

Lest you think all is gloom and doom here at Camp Crazy, sometimes known as The Citizen, I’ll tell you that despite our

differing political and world-views our staff manages to work toward a common goal and get it done every week. All the while, actually being friendly with each other.

Tuesdays in the of-fice are hectic but we try to have a little fun too. There’s been some singing going on this morning, fun for the singers (who shall remain nameless) and if it was a little off key no one was telling them.

In the middle of one of those tunes Sheila made an announcement that April 4th will be “Na-tional Hug a Newsperson Day.”

Of course we all laughed. She then had to prove it to us by looking it up on the website nation-aldaycalendar.com.

I kid you not. There is indeed such a website.

I’m sure you’re not, but just in case you are won-dering, Thursday, March 31st, the day most of you will be reading this edi-tion of the paper, is Na-tional Prom Day, National Bunsen Burner Day, Na-tional Clams on the Half Shell Day and National Tater Day. I can see my-self celebrating taters but the other things, not so much.

It seems there are plenty of food related days on the site, from chocolate macaroons to rotisserie chicken, and almost any-thing you can think of in between, there’s a nation-al day for it.

As it turns out, maybe we shouldn’t have been having fun at work today at all. National Have Fun at Work Day is January 28th. On March 28th we are supposed to celebrate Mom and Pop businesses and Lemon Chiffon cake. I’ll go on the record as be-ing in favor of both.

Now, to petition for a National Get Over Your-self and Find Some Bigger Fish to Fry Berea Day.

Pranking the King of April Fools Day

Can We Just Agree to Disagree

and Not be So Disagreeable?


Boone Tavern Named “One of South’s Best Hotels” By Southern Living

Come Out & Play Rook

Join us for a fun night of cards, great chili and delicious deserts. If you do not play Rook, you can eat and network with other members of Berea's business community and possibly win a nice door prize.

Friday, April 22, 2016 6:00 - 10:00 p.m.

$13.00 per person

Tickets can be purchased by calling 986-9760.

Chamber fundraiser to be held at: Glades Christian Church Fellowship Hall

530 Glades Road, Berea, KY

A Berea Chamber of Commerce Event

4th Annual Rook Tournament

www.BereaChamber.com

Office space previously used as a medical office but due to increased patient volume the practice needed more space and had to expand and moved to a larger space within the center. The office space would be great for any type of medical, dental, or veterinary clinics. The Kingston area is a fast growing location within Madison County. Kentucky One Health has made a great investment in the area so the demand for health care is great in this growing rural area.

Facility:• 10 Exam Rooms; each room has hand wash area, network and phone connection• 2 Bathrooms• Lab room• 2 Private offices; each with network, TV and phone connections• Utility Closet and network closet• Break Room• Reception office with check-in and check out windows, Network and Phone connection• Waiting area with TV connections• Large Paved parking area

3 year lease minimum is requested, $3200/monthly lease payment, leasee responsible for all utilities.

Call 859-661-0180 or 859-986-4127

MEDICAL OFFICE FOR LEASE 3200 SQFT FACILITY2740 Battlefield Memorial Hwy(Kingston), Berea KY





ALSO AVAILABLE...






Now Available (Homestead) 3 BR, 2 BA, 2 car garage, covered front and back porches, tray ceilings throughout. $169,900.

1016 Quincy Ct. House for Sale 3 BR, 2 BA Ranch 1,650 sq. ft. plus 2 car garage. No pets. $124,900



859-792-4025

ly five. KU and AMP-Ohio are two of the bidders.

Ed Fortner, director of Berea Municipal Utili-ties, recommended join-ing KyMEA early on, after the City of Berea cancelled their contract with KU. It’s a position he continues to take. The current KU contract will last until the spring of 2019.

“By going through KyMEA, we would have a lower cost of borrowing, the administrative costs are much lower than what we pay at KU, and there’s no return on investment,” Fortner said. “KyMEA has to answer to the munici-pal utilities that would be board members, like Berea would be if we joined. KU only answers to their stockholders.”

The municipal utilities in Kentucky that have joined KyMEA are Barbourville, Bardwell, Benham, Owens-boro, Corbin, Falmouth, Frankfort, Madisonville, Paris, and Providence; Pa-

ducah is considering mem-bership. Both Nicholasville and Bardstown chose to continue their contact with KU, however, when the electric utility offered them more favorable terms.

Tom Calkins, the utilities director of Nicholasville, said, “Everything is differ-ent now than it was two years ago. We never gave notice to KU, and they took the ten-year contract requirement off the table, and offered a lower return on investment. Our rates are now lower than Berea.”

Calkins, who also serves as the CFO of Nicholas-ville, pointed out that they, like Berea and Paris, have all three utilities under the city – water, electric, and sewer.

“This is a very compli-cated issue, and I already have trouble controlling my time,” Calkins said. “These municipal utilities that only have electric also have power boards and other infrastructure set up to manage a commitment like KyMEA.”

Fortner said the other municipal utilities that joined KyMEA have had

no conflicts with their city councils, and the utility directors’ decision to join was not challenged.

“They feel pretty sorry for me,” Fortner said wry-ly.

Fortner said he didn’t take enough time to edu-cate the city council mem-bers on the KyMEA situ-ation, and wasn’t careful enough to make sure they understood the interlocal agreement.

Some city council mem-bers have expressed con-cern that the interlocal agreement would force the City of Berea to abide by power purchasing deci-sions of the KyMEA group. Fortner said that joining the group would not ob-ligate the City of Berea to any purchase – they could take as much or as little advantage of the col-laboration as they wished. Berea could even purchase power from KU after join-ing KyMEA, though Fort-

ner said he didn’t see why they would want to make that decision.

Little, who at one city council meeting said he was, “sick of hearing about KyMEA,” stated that he is still considering all the op-tions.

“I wouldn’t be ready to make a vote at this point,” Little said, who also men-tioned that going with KyMEA “is like going to Las Vegas.”

Josh Bills, chairman of the Berea Utilities Advi-sory Board, is in favor of joining KyMEA, and sees more opportunity to in-vest in renewable energy through the group.

“It’s an opportunity that presents, potentially, the best outcome,” Bills said. “This is uncharted territo-ry, but when the city coun-cil decided to cancel their contract with KU, they chose to go into uncharted territory. We would have the opportunity to do a

significant municipal en-ergy project with our allies in Kentucky.”

Bills pointed out that the energy portfolio that KyMEA is considering has the greatest amount of re-newable energy options.

“This is really exciting,” Bills said. “We could have the lowest wholesale costs, and an opportunity for the lowest carbon footprint

with the portfolio they are considering.”

Stone said the City of Berea will be scheduling a public forum on the power purchasing decision with-in the next few weeks, af-ter the city council meets to discuss all the information from the various presenta-tions.

ENERGYCONTINUED FROM PAGE A1

People who are interest-ed in seeing all the dances of the Kinetic Expressions performance can attend on Thursday or Friday night at 8 p.m. This full perfor-mance lasts two hours, with twelve different piec-es performed. Half of the dances are choreographed

by students, and the other half are choreographed by faculty, staff, or guests. The modern dance category will be stretched a bit this year, Downs said, with the presentation of a classical Indian dance by a Berea College student, Baharta Natyuam.

The annual performance of modern dance, or Ki-netic Expressions, at Berea College started in 1997 when the faculty and staff

decided to put on a con-cert. Since then, students as well as faculty and staff are invited to “audition” their dance in the fall, when several pieces are chosen for the spring concert. The dancers then have until April to rehearse the differ-ent pieces that are chosen.

Downs, who teaches the class Improvisation and Choreography, requires her students to choreo-graph a dance as their final

project. These dances can then be entered into the Kinetic Expressions audi-tions.

“All the people who au-dition get a vote on which dances are accepted,” Downs said. “The top ten pieces get into the show.”

A guest artist is also in-vited every year. Adalhi Aranda Corn, the founder of Bluegrass Youth Ballet in Lexington, has choreo-graphed one of the pieces,

for the 11th dance in the show. The 12th piece is the finale where all 50 of the dancers participate; faculty members take turns choreographing this piece. This year, Stephanie Woody has choreographed the finale.

Downs said people would be surprised at the amount of talent that exists among the faculty and staff at Berea College when it comes to dance choreogra-

phy. A biology teacher has choreographed one of the ten pieces this year.

Tickets for the Thursday and Friday evening per-formances are $7. To order tickets, contact Downs at 985-3738, or through email at [email protected]. Sales from the tickets help to pay for the produc-tion costs.

DANCECONTINUED FROM PAGE A1

dous support among the law enforcement commu-nity, the judicial system, the detention center, and the nonprofit organizations. He did not, however, find support for the program with the elected officials of the Madison County Fiscal Court, and very little with the elected officials of the two cities.

“I was disappointed with the lack of support among the elected officials,” Soffel said. “In areas where CASA is strong, there is a good partnership with the city or county.”

Despite the lack of sup-port from the three gov-ernments, Soffel is very positive about the future of Madison County CASA, and the people he has re-cruited either for the board of directors or as volunteer advocates.

The Lunch on the Lawn, which will start at 12 p.m. on Friday, will be a swan song for Soffel, who plans to step down as the tempo-rary director of CASA on

Thursday and return to his business.

“I think that’s when my 120 days are up,” Soffel joked, “though I may have put in a couple of extra days.”

He will continue either working as an advocate or board member, however. Magistrate John Tudor will sign the Child Abuse Month Proclamation on Friday, and Judge Nora Shepherd along with Katie Ellis, the widow of Rich-mond Police Officer Daniel Ellis who was killed in No-vember, will both speak.

Ironically, the four sus-pects in the shooting of El-lis will be in the courthouse during the event. All of them, Soffel said, had large DNA (dependency, neglect, and abuse) files from when they were children.

Ellis will also be lead-ing the pinwheel planting, when people who attend the lunch event will be asked to place a pinwheel on the courthouse lawn in support of the 419 abused and neglected children re-ported in Madison County during 2015.

Soffel, who volunteered as a CASA advocate in Fay-

ette County for eight years, has stayed in touch with all the children he has worked with as an advocate.

“I’m pleased,” Soffel said, “to report that they’re all flourishing. Just because their case was finished didn’t mean our relation-ship was over. For a child who has been abused or neglected, having an adult advocate is so important.”

CASA, which started in the late 1970s, partners with the judicial system to provide volunteer advo-cates for abuse or neglected children. A juvenile court judge in Seattle started the organization, so someone could speak specifically for the abused children in court cases.

CASA volunteers who are paired up with a child are expected to stay with that case until it’s closed and the child is placed in a safe, permanent home. For many children, the CASA volunteer is the one constant adult presence in their life.

People interested in working with CASA can call 859-228-0468 or email [email protected].

CASACONTINUED FROM PAGE A1

The Historic Boone Tav-ern Hotel has been award-ed recognition by Southern Living magazine as “One of The South’s Best Hotels and Inns.”

The honor is part of the magazine’s annual “Best of the South Travel Awards” that cites top destinations for lodging, dining and other travel-related entertainment across the South.

The honor puts Boone Tavern among a select group of boutique hotels, such as the Greenbrier in West Virginia and the Peabody in Memphis, that Southern Living calls its “favorites.”

Southern Living stated, “In the early 1900s, Nellie Frost, wife of Berea Col-lege president William G. Frost, thought the area needed a great hotel to welcome visitors. In 1909, Boone Tavern was built, and it has since hosted guests including Henry Ford, Calvin Coolidge,

Eleanor Roosevelt and the Dalai Lama. A recent $11 million renovation made it the first LEED Gold-cer-tified hotel in Kentucky.”

“We are pleased that Historic Boone Tavern has been recognized by Southern Living as one of the Best Hotels in the South for 2015,” said Gary McCormick, general man-ager of Boone Tavern Ho-tel & Restaurant. “This is a tribute to our entire staff and for their hard work and dedication in making sure that every guest has a great hospitality experi-ence.”

Boone Tavern Hotel was built in 1909 by Berea Col-lege to serve as a guest house for visitors to cam-pus. Its strategic location on the old “Dixie High-way” and its reputation for fine food, comfortable accommodations and gra-cious hospitality made it a popular spot for travelers from the dawn of the au-tomobile age.

The hotel’s dining room features well-known his-torical favorites, such as “spoonbread” – a signa-ture item of Boone Tavern – and “Chicken Flakes in a Bird’s Nest” that was de-veloped by Richard Hou-gen, the innkeeper for more than three decades.

Contemporary classics on the menu include an array of appetizers, sal-ads, entrees and desserts created from Kentucky Proud® products, many of which are grown on the Berea College Farm.

The College’s students are an important part of Boone Tavern. Students help staff the hotel and restaurant, working 10-15 hours per week as part of the Berea College Labor Program that provides employment at the hotel and more than 120 other departments and work ar-eas across campus.

See the Southern Living feature at: http://www.southernliving.com/trav-

DRIVEWAY GRAVEL haul-ing & spreading. Residential 859-544-7730 35x17p________________________BEAUTIFUL LANDSCAPING,Ponds, waterfalls, edibles, natives. Pond cleanings & repairs. (606) 416-3911 Rock Castles Landscapingwww.rockcastles.net.42x6p


APARTMENT FOR RENT:2 BR, 2.5 BA. Carpet & tile, stove, refrigerator, dishwasher. No pets. References required. 859-200-3592 41xtfnb________________________ APARTMENT FOR RENT: Country setting with one car garage. 330-317-5470 43x2p ________________________ TOWNHOUSE FOR RENT:Nice, 2 BR, 2.5 BA, laundry room, appl., privacy deck. $525/mo. + dep. & ref. 986-2525 or 979-5999. 43x1b________________________STUDIO APARTMENT Small, nice for one person, near Berea College. Utilities included. No pets. $425/mo. + $400 dep. 859-302-5432. 43x1p ________________________APARTMENT FOR RENT: 1 BR Effi ciency, near Berea College. Utilities included. No pets. $500/mo. + $450 dep. 859-302-5432. 43x1p________________________FOR RENT: 2 apts. available immediately, 2 BR, 1 BA. $500/mo. Water, sewer & trash included.; 1 TOWNHOUSE- 3 BR, 2.5 BA Move in special $750. + utiliites. W/D hook-up, 2 car garage. Call Dave 859-940-6613 43x2p

HOUSE FOR RENT: 3 BR, 2.5 BA, 2 story, 1 car garage. Northway Dr. Brand new, No pets. $1000/mo. + $1000 dep. Serious inquiries only. 859-986-3389. 42xtfnb________________________HOUSE FOR RENT: Lg. 2 bed, 1.5 BA townhouse, 100-2 Morning View. $575.; Nice 2 bed, 1.5 BA duplex 115-2 Washington Ave. $615.; Nice 3 bed, 2 BA duplex 69 Hurley $725. All units have central heat & air. 986-2266. 12xtfnb________________________HOUSE FOR RENT: Nice 3 BR, 2.5 BA, 3 car garage. $1000/mo. + $1000 dep. 859-358-0201 40xtfnb ________________________BRICK HOUSE FOR RENT: 3 BR, 2 BA, full basement, screened- in porch $1000/mo. + $1000 dep. 859-358-0201 40xtfnb

HOUSE FOR SALE: 3 BR, 2 BA Ranch 1,650 sq. ft. plus 2 car garage. 1016 Quincy CT No pets. $950/mo. + $950 dep. 859-986-3389. 43xtfnb

COMMERCIAL SPACE: 3000 sq ft warehouse w/ 2 overhead doors and offi ce space. Close to I-75; Also for rent 1000 sq ft offi ce space. Call 859-661-2090 859-986-4339. 39xtfnb

LEVI JEANS $29.99, Car-hartt Jeans $26.99- Napier Brothers, 35 Public Square, Lancaster, KY. 6xtfnb________________________WANTED TO BUY: Your Antiques and collectibles. Antique glassware, furniture, quilts, all types of military items, clocks, watches (working or not), coins, and paper money. All types of gold, silver scrap, cast iron banks, toys, lighters, crock jugs, cast iron skillets, marbles, pocket knives, fi shing items, Indian Arrowheads, and much, much more. Also buying partial estates. Over 25 years experience. Call: Clarence Reece at 606-531-0467 43xtfnb________________________FREE PIANO, you must move. 625-4824 42xff ________________________WANTED: Would like to buy stationary exercise bike for home, Call 606-560-4669 or 986-1670 43x1p

NISSAN 350Z. Red, black leather interior. 2004 coupe with 70K. Six speed manual. Touring options. Looks, runs great. All touring options. $10,000 fi rm. 859 582-5806 42x4p

HELP WANTED: Hostess, retail specialist, servers. Full-time & part-time. Apply in person at Dinner Bell. 127 Plaza Dr. 40xtfnb ________________________HELP WANTED: Veterinary offi ce hiring vet techs and kennel help. Send resume to: PO Box 901 Mt.Vernon, KY 40456 42x4p________________________WELTRANS INDUSTRIAL Gearbox Repair Facility is looking for a motivated mechanical trainee for a long-term position. Some mechanical exp. is required. 606-256-0003. 43x2p ________________________DRIVERS: Round trip Intermodal! Van & Flatbed, Halls & Atoka, TN $2000.00 sign on bonus! 1yr CDL-A exp. Call JST: 1-855-482-6793 43x2p

HUGE Multi-Family Yard SaleFri. & Sat. April 1 & 2. 8AM-?324 Elm Sleigh Dr. (Tremont) Quality brand name clothing for boys, plus size, juniors (0-4), home decor, toys, books, too much to mention. A yard sale NOT to miss.________________________YARD SALE: Rain or Shine April 1 & 2. 8 a.m.-12 p.m. 501 Scenic View Circle. Lots of guy stuff , gun parts, holsters, ammo, military ammo cans, survival items, emergency food, man cave items, collectibles, glasses, crystal punch bowl sets, complete set of fi ne China, tanning bed, fi shing gear, and lots more. ________________________GARAGE SALE: 108 Oak Meadow Dr. April 1 & 2 (Fri. & Sat.) 8 a.m.- 5 p.m. Men’s & women’s clothes, lots of household items, pictures, books, misc. items. ________________________MOVING & HOUSEHOLD SALE 104 Highland Dr. Berea. Fri. & Sat. April 1 & 2. 9 a.m.- 2 p.m. Furniture, dishes, bookcases, tables, & household items.Don’t miss!________________________4 FAMILY YARD SALE: 257 Patsy Ln. 1 mile past Silver Creek School. Fri. 1 & Sat. 2. 8:30-4. Kid’s clothes size 4 through juniors, prom dresses, electric riding toys, strollers, toys, child’s recliner, Dora couch, baseball stuff , 20 inch tires. 43x1p

HUGE YARD SALE: April 1 & 2. 8 a.m. daily. Indoors, rain or shine. 2493 Lambert Rd. (off Hwy 25) Berea. Tons plus size clothing, girl’s Justice, men’s clothing, comforters, Home Interior, bikes, jewelry, shoes, lamps, whatnots, games, holiday stuff , and etc. Look for signs, turn onto Lambert Rd. Approx. 3 miles on left in basement. ________________________2 FAMILY GARAGE SALE: Burnell Homestead Estates. 1513 Phyllis Dr. Fri. & Sat. 8-? Electronics, cookware, camping equipment, vintage collectibles, holiday & home décor.________________________GARAGE SALE: Inside heated garage rain or shine. April 1 & 2. 8 a.m.- 5 p.m. 451 Logston Ln. Last sale we plan this year. Lots of diff erent stuff from the last yard sale. Wireless routers, wireless phones, bedspreads, curtains, baby items, holiday items, clothes & shoes, wall decorations, pictures, household items, books, arts and crafts supplies, etc.________________________ESTATE SALE/YARD SALE100 Bluebird Ave. 8-? Fri. & Sat. Furniture, clothes, German & Japanese glassware. ________________________YARD SALE: Fri. April 1 & Sat. April 2. 2630 Hwy 1016. Furniture, lots of misc. household items, pictures, lamps, too much to mention.

PLAZA DRIVESTORAGE

10x10 $35/mo • 10x20 $60/mo 10x40 $120/mo • 20x40 $180/mo

call/txt 200-7691, 582-4173


• APARTMENTS •





[email protected]





661-3259, 661-2306986-7692, 986-4095


____________________

Blakewood Storage

Units for Rent661-3259, 661-2306986-7692, 986-4095

• SERVICES •



• EMPLOYMENT •



Lancaster, KY





986-5644










Autumn Ridge







(859) 986-8894 or (859) 661-0036 (nights)





Call (859) 985-7077


for sale. $50,000.859-986-4095




House for Lease




• LOT •

WILESTrailer Park

SPACE FOR RENT

859 661-3259 859 986-4095


859 661-0036

APTS &

• APARTMENTS •

• VEHICLE •

• COMMERCIAL •

Call (859) 661-0304 or (859) 625-2528





• HOUSE FOR SALE •

Davis$20 - $60859-582-9710Hwy. 21 West

115 Linda Ln.

Storage Units

• YARD SALE •

BRTODD INVESTMENTS


utilities included

2 BR Apartments

(859) 661-2950

• COMMERCIAL •











(859) 986-7765TDD: (800) 648-6056

Piano TuningServices

&

Minor Repairsin homes, churches,

& schools

Roddy TatePIANO TUNING

Roddy Tate

779-3802

•Residential••Commercial••Fully Insured•

For All Your Lawn Care Needs(606) 657-8402

Mowing and Landscaping

Allen & Sons

• YARD SALE •


Kelly ServicesNOW HIRING!

Immediate openings in the Richmond/Berea Area!Production/Assembly Workers/Forklift Operators

10 - 12 hours shifts (mandatory overtime) 1st and 2nd shift placements $11.00 - $11.50 an hour

Call Kelly Services today to qualify for an appointment!859.624.1644

www.kellyservices.com

330 Eastern Bypass Ste. 2 • Richmond, KY 40475

OPEN HOUSE SUN 2-4126 Legacy Drive (Berea)

Brand new 3 BR, 2 BA ranch. Large master with large walk-in closet. Tile Shower in Master Bath, Trey ceiling in living room with gas log fireplace. Custom cabinets.Granite Counter Tops, Vaulted & Trey Ceilings. Covered Back Deck. All kitchen appliances. Oversized garage with two garage doors. Call today! MLS#53956

$209,900Sara Clark Realtor 859-358-1068

634 Chestnut Street • Berea, KY 40403 859-624-2060




(859) 986-9417home

(859) 302-8411mobile


(859) 986-9797



LAND

• 104 wooDS TRAIl | RIChMoND (DUPlEX) ........................REDUCED $159,900• 137 CRoSSING VIEw DR. ............................................................... SOLD $119,900• 911 GREENwooD DR... ......................................................................SOLD $169,900• 262 ShoRT lINE Pk. (15.25 ACRES) .......................................REDUCED $160,000• 270 wIllIAMS ST. (MT. VERNoN CoMMERCIAl) .......... REDUCED $69,900• 211 GlADES ST. ....................................................................................SOLD $121,900• 446 ChRISTMAS RIDGE RD. .............................................................SOLD $125,000• 420 PlUMTREE DR. (NEw ShINGlES) ...................................................... $127,900• 2800 RIChMoND ST. (RENFRo VAllEY) 1A. ......................REDUCED $119,000• 2780 RIChMoND ST. (RENFRo VAllEY) ............................. REDUCED $70,000

NEW LISTING

NEW REDUCED PRICE!

If you’re looking for property out in the country with only a few neighbors, this may be it! Only 0.6 mile from the New Brodhead Rd. (Hwy 150). This 15.104 Acre tract of land includes some rolling land with building sites and some wooded, sloping land that rises above the rest. Great for hunting, riding trails, and other outdoor activities. There is no road frontage, but a family member will be providing an easement through her land. Wooded land was logged in 2011. The remainder of the land has been used for horses, cows, gardens, and tobacco in the past.hwy 3245 brodhead MlS#54396 $29,900





859-986-84011-800-998-2063 • fax 986-6173

FosterRealtors®


140 TREMONT DR. 4 BR, 3 BA full finished walkout basement 2 kitchens 1 acre $209,000 MLS#53250 K Fain 582-6502 320 PINE STREET SOLD $129,500 MLS#53192 Phil Malicote 582-8882 114/116 BAUGH ST. SOLD $79,900 MLS#52567 Phil Malicote 582-8882 119 LYNNE DR. New Construction 3 BR, 2 BA $196,900 MLS#53171 Phil Malicote 582-8882 138 LORRAINE COURT (Duplex) $92,500 MLS#53010 Phil Malicote 582-8882633 KING LUKE CT. (Kings Trace) 5 BR, 3.5 BA 1 acre $229,900 MLS#51812 Janet Bowman 302-3123645 WOODSIDE WALK (Condo) 2 bdrms, 2 bths $116,000 MLS#51922 Connie Lawson: 661-0285BOX 451 RT. PENDING MLS#51191 Janet Bowman: 302-3123 914 BIG HILL Rd Mt. Vernon PENDING $75,000 MLS#50950 Janet Bowman 302-3123 79 CENTRAL AVE. 2 bdrm, 1 bth $59,000 MLS#50551 Phil Malicote 582-8882



DETAILS! 859/986-8401

5115 WALNUT MEADOW RD. 1 1/2 Story, 5 BR, 3 1/2 BA, 1 acre lot. Finished 2nd Floor with plenty of room for 2 additional bedrooms if needed $269,000 MLS#54184 Phil Malicote: 582-8882 208 PEACHBLOOM HILL SOLD $138,500 MLS#54061 Phil Malicote: 582-8882 616 C. VALLEY DRIVE 3 BR, 3 1/2 BA Log Home 40 acres $325,000 MLS#53952 Janet Bowman: 302-3123 182 E. HAITI RD. PENDING $99,900 MLS#53922 Lisa Foster: 582-1010 1050 FREEDOM SCHOOL RD. Mount Vernon 3 BR, 2 BA Doublewide on 1/2 acre lot. $59,000 MLS#53836 Don Foster: 582-1100 212 ADAMS STREET 2 BR, 1 BA Located in Artist Area Old Town Berea. Garage/Workshop $59,000 MLS#53767 Sune Frederiksen: 248-0690 1019 HONEYSUCKLE COURT 3 BR, 2 BA, 1 Acre $125,000 MLS#53735 Phil Malicote: 582-8882 726/728 O’POSSUM KINGDOM ROAD 2 BR (possible 3rd), 1 BA Recently remodeled 2.5 acres with barn, storage shed. Includes a 1,936 sq. ft. commercial bldg. currently being used as body shop with ef-ficiency apartment. $179,900 MLS#53707 Phil Malicote: 582-8882 120 N. BROADWAY STREET Historic City Jail & extra lot. Totally Updated. Great for Retail or Office. $149,500 MLS#53663 Phil Malicote: 582-8882 126 MEADOWLARK DR. 3 BR, 1 BA, $81,900 MLS#53408 Candi Vester 224-6550, Amanda Hill 661-0460

106 EXETER AVE. $27,500 Middlesboro Janet Bowman 302-3123294 DOGWOOD DR. - 0.49 Comm. Lot $100,000 MLS#52820 Candi & Amanda 224-6550 or 661-04601 PAINT LICK RD. - 6.13 Comm. Land. $1,500,000 MLS#53821 Candi & Amanda 224-6550 or 661-04601 DOGWOOD DR. - 8.51 Comm. Land $2,100,000 MLS#53822 Candi & Amanda 224-6550 or 661-0460FARM/ 2325 PEGGY FLATS RD. 182.56 acres prime farm land located 2.3 mi. from I-75. Completely fenced, 3 ponds, gently rolling. $912,500 MLS#53761 Phil Malicote: 582-8882 FARM/ 405 LOCUST BRANCH ROAD 543 acre farm, 200 year updated log home, plus modern 6 year old home. 3 barns, 2 machine sheds. Stocked pond. Guest cottage $1,200,000 MLS#53543 Phil Malicote 582-8882FARM/ 1775 GUYNN RD. 120.55 acres located within 3 mi. of I-75 & Berea.Barns, ponds, pasture, tillable land, woods & wildlife $350,000 MLS#53401 Phil Malicote 582-8882 BREEZY HOLLOW RD. 7.98 acres cleared land. Several bldg sites. $32,000 MLS#53517 Phil Malicote 582-8882

347 Pinnacle View3 BR, 3 BA, Family

Room w/possible 4th in basement Beauti-

ful view of mtns. $139,000

MLS#54413 Kristie Fain 582-6502

103 Rose Street4 BR, 2 BA.

Great Condition $134,900

MLS#54406 Phil Malicote

582-8882

105 Harrison Ct.3 BR, 2 BA, Full partial finished basement. New

updates to house. $172,000 MLS#54400

Janet Bowman 302-3123

112 Bryon Ave.(Suncrest Meadows Subd.)

3 BR 2.5 BA Full partial-finished basement, kitchen remodeled, granite counter

tops, new appliances, tile floor-ing $161,900 MLS#54395 Phil Malicote 582-8882

NEWLISTINGS



REALTY WORLD®

TM





Berea & Richmond


ONE OF OUR AGENTS!

Kim GipsonRealtor

859-200-1864


859-623-1900


859-623-1900



859-779-9935

Paul HobbsRealtor

859-979-3040

Jason WilsonRealtor

859-358-3016



859-625-2066


859-358-6083


Paula MooreRealtor

859-358-4481

Donna MabesRealtor

859-868-8847

Kenny HowellRealtor

859-979-0462


859-302-2762

Nathan HackRealtor

859-351-9303

•1703BarnettRd.Mt.Vernon$114,900MLS#54333

•702CarolinaCt.Mad.Co.NW$25,000MLS#54203

•1008QuincyCt.Berea$129,900#1605079































Aaron HackworthRealtor

859-582-9953

Zac WynnRealtor

859-314-7454

NEW LISTINGS

OPEN HOUSES SUN 2-4

NEW LISTING REDUCED PRICE!

NEW

NEWREDUCED

147 RavenDrive

Mad.Co.SE$193,500

MLS#54407

1904Lake LinvilleMt. Vernon

$72,900MLS#53773

224 AbwayStreetBerea

$59,900MLS#54402

1883 GravelLick Branch

Berea$60,000#52854

NEW 125Liberty Ave.Mad.Co.SE

$15,000MLS#54404

147 RavenDrive

Mad.Co.SE$193,500

MLS#54407

Notice is hereby given that Delta Natural Gas Company, Inc. with principal office located at 3617 Lexington Road in Winchester, Kentucky 40391, has filed an application with the Energy and Environmental Cabinet to install a natural gas line crossing at Hays Fork Creek in Madison County along Kentucky 3376 (Old Berea Road). The proposed Hays Fork Creek crossing is located 65’ northwest of the centerline of Kentucky 3376 (Old Berea Road) and 385 feet from the intersection of Kentucky 421. Any comments or objections concerning this application shall be directed to: Kentucky Division of Water, Surface Water Permit Branch, Flood Plain Management Section 200 Fair Oaks Lane, Frankfort, Kentucky 40601. Phone: (502) 534-3410.

ANTIQUES*VINTAGE TOOLS*HOUSEHOLD Auction APRIL 2 Sat. 10:00 A.M.

Location: Longview Farm Ag Bldg, 307 Mule Shed Lane Richmond, KY Concessions—Peoples Bank Relay for Life Team

STERLING Silverware (Sterling, Nickel Silver, Deep Silver–Gorham, J.W. Spenk, Victors, Holmes, H. Lauber, Farrior), Antique Wood Working Tools, Planes - #7 Stanley, #5 Bailey, Hand & Bow Saws, Clamps, Antique Hand Crank Wall Drill Press, Lg Pipe Vise, Antique Carpenters Tool Box w/lock, Draw Knives, Brace & Bits, Lg. T Handle wood augers, Scribes, Antique Knock Down Wardrobe, 2 Antique Hall Trees, Gate Leg Table w/Drawer, Victorian Chair & Table, Settee, Round Oak Table w leaf, Chest of Drawers, China Hutch, Cherry Drop Leaf Table, Dinette Table & Chair, Retro Green & White Dinette Table w 3 chairs, Yellow Dinette Ta-ble & 2 chairs, Oak Dresser w Mirror, White Drop Leaf Table, #3 Gray Salt Glaze Crock, 2 gal Whiskey Jug, Tom’s Peanut Store Jar, Corning Ware, Fiesta, Lamps, EPGlassware, Berry Bowls, Cups, Cake Plate, Creamer & Sugar, Biscuit Jar Ad-vertising, Pictures, Appliances, Housewares, Vintage Ice Cream Table/2 chairs, Madison Co Courthouse Souvenir

Creamer, Hat Pin Holders, Box Lots/More.

LONG AUCTION COMPANY WAYNE LONG 859-544 2254

NO BUYERS FEE

Section 00100Advertisement for Bids

Southern Madison Water DistrictUS 25/ RICHMOND ROAD WATER LINE RELOCATION

207 North Dogwood DriveBerea, KY 40403

Separate Sealed BIDS for the construction of US 25 I Richmond Road Water Line Relocation; KYTC Item No. 07-8505.00 will be received by the Southern Madison Water District, 207 North Dogwood Drive, Berea, KY 40403 until 11 :00 a.m. on April 7, 2016 and then publicly opened and read aloud.This contract consists of relocating approximately 1,350 L.F. of 4” PVC waterline and appurtenances.The CONTRACT DOCUMENTS may be examined at the following locations:SOUTHERN MADISON WATER DISTRICT, 207 NORTH DOGWOOD DRIVE, BEREA, KY 40403KENVIRONS, INC., 452 VERSAILLES ROAD, FRANKFORT, KY 40601F. W. DODGE/AGC, 950 CONTRACT STREET, LEXINGTON, KY 40505Copies of the CONTRACT DOCUMENTS may be obtained from Lynn Imaging, 328 Old Vine Street, Lexington, KY 40507 (859-226-5850) and www.lynnimaging.com upon payment of a nonrefundable price of $175.00 for each set plus any shipping charges.Each Bidder must accompany his bid with a Bid Bond in amount of not less than five (5) percent of the base bid. No Bidder may withdraw his bid for a period of ninety (90) days. The Bidder awarded the contract shall execute a 1 00% Performance Bond and a 100% Payment Bond and shall furnish insurance as required, in the General Conditions. This contract shall be completed within 30 calendar days after date of authorization to start work. Liquidated damages will be $600 per calendar day.Bidders must comply with the President’s Executive Order Nos. 11246 and 11375, which prohib-it discrimination in employment regarding race, creed, color, sex, or national origin. Bidders must comply with Section 3, Section 109, Title VI of the Civil Rights Act of 1964, the Anti-Kickback Act and the contract Work Hours Standard Act. Bidders must certify that they do not, and will not, maintain or provide for their employees any facilities that are segregated on a basis of race, color, creed, or national origin.Any bid that is obviously unbalanced may be rejected. Southern Madison Water District reserves the right to reject any and all bids and waive informalities. Small, minority and women’s busi-nesses and labor surplus area firms are encouraged to bid this project.

By: Larry Todd, ChairmanSouthern Madison Water District

Gator Made Trailers will be hosting a job fair

on April 2, from 8:00 am to 11:00 am at 1278 Highway 461, Somerset, KY. Hiring Experienced

MIG Welders. Start earning $15.00 per hour with the potential to earn $20+ per hour. Possible travel bonus up to $50

per week.Gator Made is a drug

and alcohol free workplace and an equal opportunity employer.

March 31, 2016

THE PIRATE Berea Community School 2 Pirate Parkway Berea, KY

PASSION, PRIDE, AND PURPOSE

Follow Us on Twitter: @BCSPirate

On Thursday, March 10, the Berea Community High School Future Business Leaders of America (FBLA) competed at Regional competition at Eastern Kentucky University, against 22 other schools in the region. Fu-ture Business Leaders of America is a membership-based organiza-tion that prepares students for careers in business and future education through varieties of community service, academic, and leadership activities. When FBLA members choose to com-pete in Business-oriented fields, they are offered an abundant and diverse array of divisions in which they can compete, such as Animation, Business Ethics, Emerging Business Issues, Global Business, and many more enrich-ing topics. “We [educators] don’t do a lot of demonstrated learning in a classroom [as much as] we should, and [one of the things

BCHS students win big at FBLA Regionalsimportant to me] is to make sure that our kids are able to demonstrate knowl-edge and to be able to compete with schools,” stated Berea Community High School FBLA Super-visor and Business/Marketing teacher Russ Shearer. Although FBLA brought back tro-phies in multiple events in last year’s regional competition, Berea witnessed many more compet-ing club members qualifying for FBLA State Competition in this year’s 2016 Regional Competi-tion : Sophomores Dante Clavere, Alex Mondine, and Freshman Ryan Whitt placed 1st in Most Talented, Freshman Emily Nigro placed 1st in Introduction to Business, Sophomores Carmen Hazelwood, Sierra Lurty, and Crystal Williams placed 1st in

Emerging Business Issues, Junior Malcolm Davis placed 1st in Impromptu Speaking, Juniors Ty Robinson and Wynn Mcdonald placed 1st in Management Infor-mation Systems, Junior Jordan Adams placed 1st in Insurance and Risk Management, Juniors Vanessa Patel, Izzy Whatley, and Candace Elam placed 3rd in Global Business, Junior Sam House placed 2nd in Networking

On Monday, March 21, sev-eral Berea Community High School juniors and seniors were inducted into the National Honor Society during the Berea Board of Education meeting in the Ken-nedy Theatre. The ceremony was conducted by current society members. Current members lit four candles on stage, one for each pillar of the society: scholarship, leadership, service, and character. With each pillar, a current mem-ber read a small speech which described its importance to the organization. At the end, all the inductees held a small candle and recited a pledge. Junior Sam House said, “It was an honor to be able to become a part of NHS. The candle lighting was special.” Linda Williams, a former NHS sponsor of eight years, and Eef Fontanez are the co-sponsors of Berea Communities chapter of NHS. Williams says to be induct-ed into NHS is, “both a privilege and a responsibility because, by

getting in, students have to dem-onstrate an enormous amount of leadership and service.” Many of the NHS members are already a part of Student Council or other associations that focus on service. Therefore NHS and the other associations co-inside when it comes to events like Sara Care, food drives and spirit weeks. The newly inducted members are: Jordan Adams, Denise Burdine, Carissa Coy, McKenzie Daugherty, Malcolm Davis Can-dace Elam, Dalton Gadd, Alex-andria Horn, Sam House, Austin Jennings, Jared Kilgore, Mallory Lakes, Jennifer Lee, Catrina Mc-Collum, Wynn McDonald, Katie Okumu, Vanessa Patel, McK-enzie Perry, Patty Phillips, Elvia Rojas, Maria Rojas, Olivia Reyes, Ty Robinson, Karmadri Santiago, Cherish Simpson, Chloe Skeese, Jayson Smith Roy Smith and Isabella Whatley Linda Williams said, “These students who were inducted are the same ones that we hope will take those leadership and service skills into the world to truly make it a better place.”

Juniors inducted into National Honors Society


Berea FBLA chapter (above) after Regional competition. Photo submitted

The booming of trombones, the purr of flutes, and the bold-ness of trumpets were heard all around Madison County as the annual high school band compe-tition festival was held at Eastern Kentucky University’s Center for the Arts on March 23, 2016. Berea Community High School was in attendance and scored distin-guished, for the second year in a row, on both sight reading and performance. The competition consists of two different categories. In the sight reading section of the competi-tion, bands are given a piece of new music and must perform the song with no prior knowl-

edge of the score. In the perfor-mance section, bands play three chosen pieces that they have been practicing for months in advance. There are three judges for the performance category and one judge for the sight reading section. Bands are rated on a scale from 1-4 based on their tone quality, in-tonation, interpretation, technique, rhythm, and balance. High schools from around the area are invited to attend the band festival. According to Berea Com-munity High School band direc-tor Matthew Barnhill, the concert band spent around five months preparing the pieces for the performance section. The group performed “Festivo” by Vaclav Nelhybel, “Ammerland” by Jacob

concepts, Seniors Claire Hogg, Emma White, and Kerri Adkins placed 1st in Business Ethics, Seniors Greg Schloemer and Hunter West placed 1st in Net-work Design, Senior Claire Sand-berg placed 1st in Accounting II, and Senior JD Lovell placed 2nd in Job Interview. “[FBLA is important] because it teaches you important traits that you need to continue to

use throughout high school and college and life in general,”stated Senior Claire Sandberg,”it’s a great way to find friends that are interested in the same things that you are or to broaden your horizons.”With a record amount of club members advancing to State Competition, Berea Com-munity made a great display of its accomplishments, despite the fact of competing against much larger schools. “FBLA is an important [group] at our school because it’s one of [the very few groups at Berea] where we can take 50 to 60 kids from a school of about 350 kids and compete with the Pulaski counties and the Madison counties and the Estill counties where they’ll have 700 or 800 kids to choose from. I think it’s very important that we finished 3rd overall, with a school from just 350 kids. I think that’s very important.” Members Qualifying for State Competition will begin competi-tion on April 18.

de Haan, and “Algorhythms” by Gary Fagan. These pieces, along with the band’s sight reading, landed them high markings in the event. Berea Community High School senior Jayson Smith has been a member of the band for the majority of his high school career. Smith expressed his pride in the band’s hard work: “We came in very prepared and got distin-guished on both sight reading and our normal symphonic band. It makes me really happy to see all of our practice time yielding such a positive outcome.” The band will compete again at the band festival next year and Barnhill is hoping for a three-peat of their success.

Berea band distinguished for second year

WORDFEST 2016 TONIGHT 6-6:30 p.m. Open House

6:30-7:30 p.m. Ice cream and Writing Workshops

Community Elibibility Program considered

On Tuesday, March 15, the Berea Community School Board met in the Middle and High School li-brary to discuss providing the whole school with free breakfast and lunch. This would be a new system put into place by the cafeteria workers at the start of the next school year in August. It is a program called The Community Eligibility Pro-vision, or CEP. This will change the way students get food from the cafeteria, because they will know longer have to pay at the end of the line, so there is room to try some things that haven’t been done before.

“We are working on having a grab and go breakfast op-

tion for middle and high school students, so they all have fuel for the day,” said Superintendent Mike Hogg. The cafeteria at Berea Community Schools cur-rently serves nine hundred lunches and four hundred breakfasts each day. Un-der the new program, the school hopes to raise the number of breakfasts and lunches served. In the pilot schools (schools who are the first to try this program), the number of students that got a school breakfast increased by 25 percent and the number of lunches increased by 13 percent. Qualifying schools are schools with forty percent of students who are “iden-tified”. These students

qualify for the free and reduced lunches. The pro-gram takes out the need for schools to worry about students who can’t pay for lunch.At the Berea Community School Board’s meeting, the decision was unani-mous to implement this new program. “I was glad to see folks come out to the meeting and have a discussion fo-cused on work to meet the needs of students so they are ready to learn. If stu-dents are hungry, learning can be negatively influ-enced,” said Mike Hogg. Because of the progress of the School Board, next school year, Berea Com-munity School’s students will be provided with free breakfast and lunch.

People make many important decisions throughout life. For example, people decide where they’ll live, how they’ll earn money, who they’ll marry (or if they marry at all), and whether they’ll have kids . These are all large life choices. On March 16, Berea Commu-nity High School’s health class went on a life choices field trip. The students traveled to Rich-mond, KY. The class first went to drug court where they learned about the process that those pros-ecuted with criminal offenses go through. Next, they toured the Madison County Detention Cen-ter, visiting the jail cells, security room, the cafeteria, and recre-ational areas. The students saw how the choices you make in life can lead to irreversible causes when the visited the Morgue, and lastly the Davis and Powell

Funeral Home. “The part I liked most about the trip is that each one of the locations we went could’ve been associated with substance abuse,” said sophomore Wade Bradford. The trip had a big affect on the attitudes of the students attend-ing. Most of the students said they were surprised to see how many inmates were trusted to walk around and help work.

“What I thought was the point of this field trip was to show us what would happen if we did drugs,” said Garret Pain. In the end, some choices will be the most important decisions a person will ever make. Whether these choices are for better or worse, you will have to accept the consequences, even though they may change your life. Berea Community High School’s health class attempted to help students make positive choices with the life choices field trip.


Claire hoggPirate Managing Edtior

Kyra MorganPirate Staff Reporter

Life Choices focus of field tripBilyy riChMondPirate Staff Reporter

* Congratulations to Senior Nick Galloway who came in 2nd

overall and 2nd in age in the Officer Ellis 5K.

Spring BreakApril 4-8, 2016

THE PIRATE STAFF

SENIOR EDITOR: Katie Okumu

SPORTS EDITOR: Kenzi Daugherty

JR. SPORTS EDITOR: Clay Beavin

MANAGING EDITORS: Virginia Deaver, Claire Hogg, and Greg Schloemer

REPORTERS: Obi Okumu, JD Lovell, Huaiyu Chen, Tyler Isaac, Billy Richmond, Kyra Morgan,

Brandon Doering, Joseph Caudill, and Abner Krouse

LEAD PHOTOGRAPHER: Emma White

ADVISER: Mrs. Angela Baker

BEREA COmmUNIty SChOOl NEwS

The Pirate is published by the BCHS Journalism Class

Monday evening, the Berea Pirates suffered a defeat from the Clinton County Bulldogs. The game only lasted 5 innings, Clinton County scored 15 runs against Berea’s 5 runs. Accord-ing to the mercy rule play stops after a ten point deficit is created, causing Berea to drop to a record of 0-3. Senior Trevor Woods knew that the Pirates were at a disadvan-tage. “I felt alright about it, we knew there were some challenges coming into the game, our pitch-ers were not well rested and that makes defending difficult,” said Woods after scoring 2 runs Mon-day evening. The first inning proved to be one of the most difficult points of

the game. The Bulldogs opened up the inning with 6 runs, so the Pirates had their work cut out for them. They gave a great effort offensively, but failed to defend when they needed to. Despite their shortcomings on Monday, Jayson Smith takes this as a learning opportunity, rather than looking upon it negatively.

“We need to improve and rest our bullpen [pitchers] and get back to the fundamentals, we are making stupid mistakes that could easily be avoided. Those are the facts we have to accept if we want to stay competitive.” Smith had an excellent night, recording two hits for two at bats, a single and a double.The team had a batting average of .473 on Monday; the Pirates have no problem getting on base,

but had a problem defending it. With 7 errors and giving up 13 unearned runs, the weak point was evident. “Our offense is way ahead of our defense right now and I’m ok with that, you know? We had to spend most of our pre-season practicing in the gym, due to the weather, so our primary focus was hitting. Hitting the ball better from top to bottom of our line up is one of our goals this year and thus far we are doing that very well.” Coach Steven Bailey added after the game. The Pirates have a difficult schedule ahead of them but are confident in their ability to stay strong and compete this season. The Pirates travel to Paris on April the eleventh to take on the Grey-hounds. The BCHS softball team girls

had a loss at East Jessamine County on March 29. The game was a close tie with a score of 2-3. “Everyone has been work-ing hard as a team, and we have improved greatly,” said junior softball player Jordan Sanderfur. The J.V team also played that night, giving it their all against East Jessamine. The game had several stand-out performances, especially from team member Sandefur, who scored two home runs. Seniors Della Walters took lead the team and was responsible for cheer-

Jd lovellPirate Staff Reporter

Pirate Baseball falls to Clinton

ing and supporting the lady pirates at the game. Walters was also a great at scoring many out’s for the lady Pirates team. “Ally Mcmahan has done a great job this season, and has improved on pitching,” Sand-efur said. Strong players also included Miranda Gooch who smartly got a player from east Jessamine out. “The team this season is doing great and have performed in their best condition.” Added Sanderfur. Freshman Brooke Castle gave it her best during a pitch, Drawing applause for her effort at the bat. Though the game was a loss, the Pirates played a great game. They will surely win victory as the season progresses.

oBi oKuMuPirate Staff Reporter

The Berea Pirate tennis team has begun the season steadily. They entered Monday, March 28’s match at .500 (2-2) with wins over Rockcastle County and Danville and losses to Madison Central and Boyle County. The Pirates took on Garrard County Monday night at the Wilson Evans Tennis Complex at Berea College. The team struggled against Garrard County, with the girls dropping eight matches and only winning two and the boys losing 6 matches and only win-ning 3. Despite this, there were many

positives to draw from the match. Sophomore David Gadd was the Pirates top seeded player, mean-ing he took on Garrard County’s top seed. Gadd won convincingly, recording a score of 8 games to 0, keeping Gadd undefeated on the season. Senior Dalton Gadd also recorded a win, beating his oppo-nent 8 to 4. David and Dalton (no relation) also won their doubles match 8 to 1. Juniors Alexandria Horn and Candace Elam record-ed their teams only wins, both winning in a tie breaker in singles play. Dalton Gadd said about the match, “I felt pretty good about the outcome of it. David Gadd and myself came out with big wins in singles and in doubles. I

Clay BeavinPirate Junior Sports Editor

On Saturday, March 12, the BCHS Track & Field team com-peted in Williamsburg, KY at the Williamsburg Frostbite Relay Meet, marking the start of their season. For both the Boys and Girls teams, the meet was a huge suc-cess. Sophomore Taiza Alexander placed first in Long Jump. Ad-ditionally, the Girls 4x100m relay and the Distance Medley events placed in the top 10 overall. Berea competitors in the field events also experienced success, and for all Pirates, the day was a fun, action-packed competition.

“It was good to start the season off with a win in my event,” said Alexander. “We all did well and got to have fun doing events we wouldn’t normally do, and I’m excited for upcoming meets and practices.” In the months leading up to this match, the Pirates were hard at work preparing for the season. In her first season with Berea, Head Coach Erica Woods commented on the dedication that many Pirate athletes have put forth in the offseason in order to prepare themselves to compete. “Some students have participated in in-door meets, do workouts outside of practice, and find time to get a workout in when we haven’t held practices,” Woods said. “For a

coach, that is a phenomenal thing to witness and knowing they are willing to put in the work, they will reap those benefits as we delve deeper into the season.” Though they had a great deal of success in the first meet alone, Woods noted that she still has a number of goals to fulfill before the season ends. “There are a lot of new athletes this year and I want to peak their interest in the sport as well,” she noted. “I love this sport and want to share my passion with my athletes, so we’re going to compete, but we’re going to enjoy doing what we do.” The Pirates have already begun preparation for their next meet, which will take place on Tuesday, April 12 at Madison Central.

Track & Field compete in Williamsburg Relay Meetgreg sChloeMerPirate Managing Edtior

The Berea Community High School drama department show-cased their production of Our Miss Brooks on March 17-19. The show was directed by high school drama teacher, Jody Flara and student directed by senior Greg Schloemer. Our Miss Brooks is a play that chronicles the struggles of a high school English teacher (Miss Brooks) who, every year, is put in the very stressful position of directing the school play without the resources needed to do so. Hugo, the high school basketball coach, has had conflict with Miss

Berea Community Players Present: “our miss Brooks”

Brooks in the past over use of the school gym between putting on plays and basketball practice. Secretly, Miss Brooks is head over heels for Hugo and tries desperately to impress him. Ted, a high school basketball player, is in detention after school with Miss Brooks one day and decides he wants to be in his first high school play. This causes a very hysterical conflict between Hugo (Basketball Coach) and Miss Brooks because Hugo doesn’t want his star player to get caught up in drama and not be able to put basketball as his first priority. Jane is a girl who the basketball jock, Ted, wouldn’t have ever even noticed without joining the

high school play, and she and Ted fall for each other as well. Our Miss Brooks is filled with comical as well as heartwarming moments that are destined to entertain. There are three main ways that plays are directed at Berea Community High School. Most plays have both a student and a main director, but some can be singularly directed by either a student or Ms. Flara. In the case of a co-directed play, actors get a lot more feedback and the targeted audience becomes larger be-cause the play appeals to a larger general public. On the other hand, singularly directed plays reveal more of a director’s personal

touch. But what does this mean for the actors? “ Overall, in both situations of directing, construc-tive criticism from the director helps you build your character,” said senior performer Daniel Montoya. Emma White took on the lead-ing role of Miss Brooks in this production and executed her role beautifully; playing a well witted, stressed out Miss Brooks perfectly. Levi Saderholm also had an outstanding performance as the character of Ted. His character was very sarcastic and was bound to keep you laughing throughout the duration of the play. Some other standout perfor-mances were Miss Finch, played

by Claire Hogg, Hugo, played by J.D. Lovell, Principal Wadsworth, played by Daniel Montoya, Jane, played by Katie Okumu, and Rhonda, played by Virginia Deaver. All these characters had their own personality and the cast did a tremendous job in their performances. Greg Schloemer, the student director of Our Miss Brooks, said,

“I am extremely proud of every-one’s performance. They put in a lot of hard work and it really paid off.” The next high school play will be Brighton Beach Memoirs. Be sure to come out and enjoy this production on May 5,6,7 at 7:00 p.m.

Cyberbullying is when a person is tormented, threatened, ha-rassed, humiliated, embarrassed or otherwise targeted by another person using the Internet or mes-saging. Recently, cyberbullying has taken a new form on a social media network and is specifically targeting students. In November of 2014, an anony-mous social network app called

“After School” launched. This app gave middle and high school students all over the U.S. access to post secrets and gossip anony-mously to their classmates. 22,300 public schools in the U.S. each have their own page on After School on which students

Tyler isaaCPirate Staff Reporter

from their school to post. Right after the app launched, there were multiple threats posted that caused the FBI and police to get involved. These problems spanned all the way to the extreme of bringing a gun to school, and included an abun-dance of cyberbullying. After School’s creators, Cory Levy and Michael Callahan, were soon forced by Apple to update the app’s safety features. In response to being taken down from the App Store for a brief period, the app creators added a

“report” button so that students could report any inappropriate or threatening posts, and changed the app’s age rating to “17+” (the rating was originally 12+). Additionally, to protect the

safety of the app’s users, the creators developed a content filter that would automatically report the user if there were attempts to include violent words in students’ posts. Unfortunately, even their im-provements don’t catch every-thing, and cyberbullying is still an evident problem within the app. Freshman Blake Maupin said,

“I’ve seen on several occasions people calling out others, just to try to start something at school...it has turned into gossip central.” For students at BCHS and other high schools around the country, apps like After School are being misused. School administrators are focused on protecting stu-dents and creating a safe online environment for all.

Cyberbullying takes on new form in “Afterschool App”eMMa WhiTePirate Lead Photographer

photo Tyler Isaac

Emma White (front) as Ms. Brooks reads from play as students played by Levi Saderholm and Kyra Morgan (back) listen.

photo JD Lovell

Freshman Zane Brown bats at Monday night’s game.

know everyone played hard, but Garrard County is a very solid team.” Elam said about her match, “It was really tough and close. She was a great player, but I ce out on top.” The team will be working hard to bounce back from the loss and recapture a winning record. They play again against Madison Southern and Lincoln County in a tri-match on April 12.

Tennis team tries to bounce back

BCHS Softball loses to East Jessamine


Corbin | La Grange | Lexington | Louisville | Madisonville | Paducah | Richmond

Centered on you

Because you’re centered on our patients, we’re glad

there’s a day centered on you.

In CelebratIon of doCtors’ day 2016, Baptist Health Richmond would like to express our gratitude

to each and every physician on our medical staff. Your expertise, skill and, most important, your dedication to

patients, make up the very foundation of our patient-centric approach to care. Thank you for everything you do

and for all the lives you touch – every day.

To start building a relationship with an outstanding Baptist Health Richmond physician, call 859.625.3795 or

visit baptistHealth.com.

baptistHealth.com

89899_BHSI_DocDayRICH_11_25x21_5c.indd 1 3/28/16 9:36 AM

CITY OF BEREA


King’s Eye Care






PLANS ACCEPTED

“What is your favorite thought

or memory of flowers?”

Blake Durham said, “Looking at and enjoying flowers in my cousin’s

greenhouse in Liberty, Ky.”

Gin Petty said, “Little yellow trout lil-ies blooming by the creek back home.”

Cheyenne Olson said, “Seeing beautiful sunflowers grow in the

Berea Urban Farm.”



Like Us On




NEW CAR WASH

COMING SOON!


Service & Repair


Rederings provided by Brandstetter Carroll Inc.Berea City Council recently reviewed these final drawings of the Municipal, Police and Fire campus that is being proposed. Though bids have not been received for the project, city offi-cials have stated that it may cost around $10.4 million. The campus would extend to the edge of the city’s property by First Christian Church, and there would be a handicapped accessible walkway from the church to the city campus, since the parking lots would no longer be con-nected. Much of the original city hall building would be preserved, with additional construc-tion to the sides and back. The county clerk’s office will be moved to the old post office next door, so all county functions would be in one building. City council meetings would still take place in the courtroom. There would be a separate entrance and exit to Chestnut Street.

Proposed City Hall, Police & Fire Station

Rear View




NEWSPAPER








Local News

M A R R I A G E S

March 5Lauren Beverly Dis-

ney, 23, Richmond, florist, to Garrett Cole Fryrear, 24, Richmond, insurance agent

March 10Samantha Ann Grant, 31,

Richmond, cook, to James Allen Todd, Jr., 41, Rich-mond, restaurant

March 12Brandy Nicole Lawson,

34, Richmond, banker, to Dewey Lee Adkins, Jr., 44, Richmond, self-employed

March 16Linda Carol Hender-

son, 47, Richmond, cook,

to Thomas Ray Moore, 45, Richmond, disabled

March 18Tabitha Lynn Brock, 27,

Richmond, food service, to Joseph Wade Napier, 27, Richmond, groundskeeper

Victoria June Mullins, 31, Richmond, unemployed, to Matthew Eugene Mau-pin, 28, Richmond, sub-contractor

March 19Robert Dickson Perman,

44, Berea, shipping control-ler, to Rebecca Ann Spires, 44, Berea, homemaker

Morgan Mary-Francis Anderson, 23, Richmond,

student, to Jonathan Noah Blount, 23, Richmond, in-surance agent

Johnny Raymond Keeton, 29, Corbin, direc-tor of IT, to Falon Louise John, 26, Corbin, HR sup-port

March 20Toffee Lovett Robinson,

50, Richmond, custodi-an, to Anthony Thurman Whittamore, 49, Rich-mond, painter

Calder Timothy Ruth, 23, Berea, student, to Jodie Deanne Mullins, 21, Berea, student



he was in there!

Join in the hunt!


monthly drawing to



The winners of the 2015 Weatherford Awards were Nickole Brown’s Fanny Says (poetry), Robert Gipe’s Trampoline (fiction) and Studying Appalachian Studies: Making the Path by Walking, edited by Chad Berry, Shaunna Scott and Phillip Obermiller (non-fiction).

The Weatherford Awards honor books that “best il-luminate the challenges, personalities and unique qualities of the Appala-chian South.” Granted by Berea College and the Appalachian Studies As-sociation for 36 years, the awards commemorate the life and achievements of W.D. Weatherford, Sr., a pioneer and leading figure in Appalachian develop-

ment, youth work and race relations, and of his son, Willis D. Weatherford, Jr., who was Berea College president from 1967 – 84.

These winning authors will be recognized at the 2016 Appalachian Studies Association Conference at Shepherd University in Shepherdstown, West Vir-ginia.

Nickole Brown’s Fanny Says (BOA Editions) is an “unleashed love song” to Brown’s late grandmother. A cross-genre collection that reads like a novel, this hilarious and often wrenching book is both a collection of oral history and a moving and lyrical biography that wrestles with the complexities of the South, including pov-

erty, racism and domestic violence.

One Weatherford Poetry judge said about Fanny Says, “I’ve known Fanny my whole life because in her I see the personality and nuances of many Ap-palachian women.” An-other said: “Fanny Says is a declaration of indepen-dence and strength for ru-ral women told in innova-tive and interesting poems that never failed to get me excited about the art of po-etry.”

Finalists for the 2015 Weatherford Award in po-etry are Pauletta Hansel’s Tangle (Don Madres Press) and William Wright’s Tree Heresies (Mercer Univer-sity Press).

Shannon Johnson Students Named to Honor Roll

Sgt. Jake Reed from Berea Police Depart-ment was one of 21 law enforcement executives from agencies across Kentucky who graduated from the Criminal Justice Executive Development (CJED) program, an ad-vanced leadership course designed for supervisors at the state’s small- and medium-size agencies

The 21 graduates com-

prised the Department of Criminal Justice Train-ing’s 18th CJED class. CJED is a five-week pro-gram that focuses on identifying, analyzing and solving problems as well as leadership, per-sonnel administration, operations, fiscal man-agement, executive and environmental relation-ships.

Weatherford Awards Given to Books that “Illuminate Appalachian South”




08:00—08:45


200 Harrison Road



Information






Registration Form



Zip Code:______________







Date: ___________________




Several students from Shannon Johnson Elemen-tary were named to the honor roll.

Fifth graders from the classes of Mrs. Cress, Mrs. Emanuel, Mrs. Smith and Mrs. Webb on the honor roll were Trent Allen, Riley Ballinger, Mollie Blevins, Linzi Brewer, Cole Car-penter, Jada Carter, Kacey Cashin, Jackson Chambers, Iris Chen, Hannah Clark, Landon Combs, Makay-leigh Curry, Marissa Dan-iels, Maggie Davenport, Abby Dees, Braxton Ed-wards, Cayden Fee, Julian-na Flannery, Gavin Foley, Lauren Foley, Keith Fos-ter, Jake Grant, Cameron Hechemy, Leah Hendrick-son, Frederick Huguely, Emma Johnson, Kylie Johnson, Camilla Julian, Maddy King, Alex Kling,

Kyle Linville, Keaton Lo-pez, Gracie Lynch, Hunter May, Collin McAfee, Sky-ler Messina, Bella Mober-ly, Isaac Moore, Caden Otey, Emily Parsons, Au-brey Peters, Blain Prather, Drew Richmond, Mallory Robinson, Sierra Rose, Trenton Rose, Shelby Sco-ville, Conor Sharp, Amber Short, Madilyn Sizemore, Jacob Stone, Mason Strat-ton, Hadlee Todd, Trenten Todd, Brycen Valdez, and Trenton Wilson.

Students in Mrs. Abner’s fourth grade class on the honor roll were Hayden Browning, Channing Ca-tron, Lessie Clemmons, Claire Cress, Adaleigh Curry, Savannah Haley, Abby Hughes, Sarah Les-lie, Elijah Luna, Canaan Mays, Abby Prather, and Lauren Short.

Students in Mrs. Congle-ton’ s fourth grade class on the honor roll were Rachel Baker, Reed Barnett, Ja-cob Briggs, Jenna Briggs, Rebekah Christopher, Sa-vannah Cole, Mallory Du-erson, Thomas Hayes, An-druw Hess, Mason Himes, Anna Parker-Harris, Han-nah Powell, Halynn Puck-ett, Connor Robinson, Cadence St. Onge, Bryson Stephens, Mollie Stoneci-pher, and Shaylee Young.

Students in Ms. Ed-wards’ fourth grade class were Kennedy Barker, Isabel Bequette, Clay-ton Darst, Madison Dil-lion, Bella Durham, Brady Fields, Jade Groover, Hayden Haselwood, Abby McMullin, Caiden Miller, Kyra Perch, Riley Ritchie, Wyatt St. Onge, and Holly Beth Whitaker

Reed Graduates CJED Program

WOR

D S

EARCH


SUDOKU ANSW

ER:CROSSW

ORD ANSWER:

A: Austin Mahone

A: Zak Bagans

A: Michael Rooker

A: Alexis Jordan

A: Gabriella Wilde

April 3 – 9

Guess

I was born on April 4, 1996, in San Antonio, TX. I recorded

the hit single, “Say Some-thin’.” Who am I?

I was born on April 5, 1977, in Washington, D.C. I am the lead investigator on Ghost

Adventures. Who am I?

I was born on April 6, 1955, in Jasper, AL. I played Row-dy Burns in Days of Thunder.

Who am I?

I was born on April 7, 1992, in Columbia, SC. I recorded the hit single, “Happiness.”

Who am I?

I was born on April 8, 1989, in Basingstoke, Hampshire,

England. I played Jade Butterfi eld in Endless Love.

Who am I?

who’sturning another year

older this week!

ACIDSAGREEATLASATOMICBLADEBOXERCUDDLECURVESDARES

DATINGDRESSEATENERRORFINERFLAMESFRUITGASESHUTCH

JELLOLABORLEDGEMEDALMUMMYNAILINGNANNYNATIONSNECTAR

PAIRSPILESREFUSEDRESERVATIONROBOTSCISSORSSENSESEVENSSHARK

SMASHSOILSSOUNDSSPAINSTEELSTERNSTOUTSTRIKESUBJECT

SUNBURNEDTALLERTRAGICTRIESUSUALWIDTHWIRED CROSSWORD PUZZLE

ACROSS

1. “ER” DOCTOR5. ____ VS. GOLIATH10. BLACK BIRD13. BLACK, IN POETRY14. BABA GHANOUSH INGREDIENT15. “ALADDIN” PRINCE16. TO REMOVE GOVERNMENT REGU-LATORY CONTROLS18. FEMININE SIDE19. LAND20. BRANCH21. TWO YEAR OLD DOE22. INNOCENT23. MUCH LESS25. ___ EL AMARNA, EGYPT26. ENDURE28. PUT ON, AS CARGO29. BATTLEFIELD SHOUT31. BIT32. THE ART OF TAKING PICTURES35. ALUMINUM COIN OF BURMA36. FLIRTATIOUS WOMEN37. CLIFFSIDE DWELLING39. ADVERTISING SIGN40. “ACID”43. ______ SILVER

46. SEE-THROUGH SHEET48. BOLIVIAN EXPORT49. “MUCH ___ ABOUT NOTHING”50. INFINITE AMOUNT OF TIME51. ___ V. WADE52. THE “BOX” IN HOCKEY54. A PINT, MAYBE55. RELATING TO HOLY OBSERVANCES56. AUG. FOLLOWER57. “ABSOLUTELY!”58. BUMPER STICKER WORD59. “___ QUAM VIDERI” (NORTH CAROLINA’S MOTTO)

DOWN

1. BLUE-PENCIL2. TROPICAL AFRICAN TREE3. REDDISH BROWN4. CONTEMPTUOUS LOOK5. BROAD VALLEY6. “BINGO!”7. AQUA ___8. DEAD TO THE WORLD9. CHEERLESS10. EVERYDAY ROUTINE (3 WDS.)11. TURNED AWAY12. RAPID OR SWIFT

14. SMALL, POWERFUL TOWING SHIP17. SOUTH AMERICAN COWBOY23. GARMENT COVERING FROM ANKLE TO KNEE24. THIN, NARROW STRIPS OF WOOD27. HIGH SCHOOL FORMAL DANCE29. COMMITTEE HEAD30. COASTAL RAPTOR32. MOUNTAIN RANGE BETWEEN SPAIN AND FRANCE33. SALAMANDERS THAT INHABIT PONDS OF MEXICO34. EXTREME POVERTY35. STALK OF A PLANT IN WHICH THE LEAF IS ATTACHED37. LEAD ___38. GO BY, AS TIME40. FORMER MONEY OF ACCOUNT OF FRANCE41. IMBUES42. TO ASSESS AT A LOWER VALUE44. ARCHETYPE45. PRESENT47. “CUT IT OUT!”50. APARTMENT53. PARENTHESIS, ESSENTIALLY


8 5 2 6 1 7 9 4 37 3 9 5 8 4 6 1 21 6 4 3 9 2 7 8 59 7 5 8 4 3 2 6 14 1 6 2 7 9 3 5 82 8 3 1 5 6 4 9 73 2 1 9 6 8 5 7 45 9 7 4 3 1 8 2 66 4 8 7 2 5 1 3 9

SUDOKU


AND INFORMATION

CALL

SHEILA JOHNSON

986-0959

CryptoQuiz

She founded the American Red Cross:

____________________________________

Answers: 1) Maryland, 2) Teacher, 3) Civil War,4) Nurse, 5) Humanitarian, Clara Barton

Each of the following cryptograms is a clue to the identity of a woman in history. Using the hints U=A and D=R, decipher the clues to name the woman.

L U D X H U W Q_______________________

N R U J K R D_______________________

J O B O H S U D_______________________

W E D P R_______________________

K E L U W O N U D O U W_______________________

3

2

4

5

1

Whiten Your Smile

Help a Child



Melissa Jones, DMD



2




8 2 6 7

7 5 8 1

9 2 5

5 3

4 6 7 3 8

1 4

3 9 6

9 3 1 6

7 5 1 9











®-NO BULL-


Come See the





• Calvary Apostolic Church, 1350 Paint Lick Rd., Sunday worship 2 p.m., Pastor Josh Hampton. For de-tails, call 302-3926 www.cacberea.com




























































































REPLACEMENT RENTALS


(859) 986-7712


(859) 986-7595


(859) 985-2596


(859) 985-7371





office (859) 986-1802





P-CAB

986-1111



“God writes the Gospel not in the Bible alone, but also on trees, and in the flowers and

clouds and stars.”

-- Martin Luther




“I have always found that mercy bears richer fruits than strict justice.”

-- Abraham Lincoln


(859) 985-5577



[email protected]


























































Regular meetings

Calendar of eventsMarch 31• Berea College convo -- Karim Nagi speaks on

Arab Identity and the Arts: Diaspora and Outreach, 3 p.m., Phelps Stokes Auditorium. Nagi, musician and orator, speaks on misunderstanding of Arabs. Will perform Arab music and dance to educate.


• Free afternoon movie, 3:30 p.m., Madison County Public Library in Berea. Showing Grease LIVE. Rated PG.





• Film screening of After Coal, 7 - 9 p.m., Appala-chian Center Gallery. Film explores what happened to South Wales when coal mines shut down, to in-form eastern Kentucky.

March 31 - April 2• Theater Performance - Escape from Happiness

by George F. Walker, 8 p.m., McGaw Theatre behind Draper at Berea College. For ticket reservations, call 985-3300.

April 2• Berea Spring Fling, 9 a.m. - 1 p.m., Russel Ac-

ton Folk Center. Free fun for everyone.• Felting Demonstration, 10:30 a.m. - 3:30 p.m.,

Kentucky Artisan Center. Vallorie Henderson will demonstrate Nuno, a Japanese felting technique.

• Michael Combs in Concert, 7 p.m., Dixie Park Cornerstone Church on N. Powell Ave. Love offering will be taken. 893-8086.

• Maker Mania!, 12 p.m., Madison County Public Library in Berea. Time to pull projects off the back burner to work on.


April 3• Chess Club, 1 p.m., Madison County Public Li-

brary in Berea. All ages and skill levels welcome.

April 4• Lego Club, 3:30 p.m., Madison County Public

Library in Berea. For ages 6 to 14.• Aerobics, 5:35 p.m., Russel Acton Folk Center.


- 8 p.m., Intergenerational Center behind folk cen-ter. No experience necessary - beginners from 5:30 - 6:30 and intermediates from 6:30 - 8 p.m.

April 5• Baby and Toddler Time, 10:30 a.m., Madison

County Public Library in Berea. For ages 0 - 2 1/2.• Madison County Dulcimer Group Session, 1- 4

p.m., Intergenerational Center. No experience nec-essary. Join in the jam, 1 - 2 p.m. with beginners and 2 - 4 p.m. with intermediates.

• One-on-One Computer Help, 12 p.m., Madison County Public Library in Berea. Classes designed to answer all questions about computers.


April 6• Buddhism, Haiku, and a Sense of Place, 5:30

p.m., Loyal Jones Appalachian Center. Dr. Chris Green to share poetry and reflections on connec-tions between Buddhism, haiki, and Appalachia.

• One-on-One Computer Help, 12 p.m., Madison County Public Library in Berea. Classes designed to answer all questions about computers.

• Crafternoon: Stone Magnets, 3:30 p.m., Madi-son County Public Library in Berea. Make stone magnets with magazine and comic book images.

• Basic Spanish for Adults, 6 p.m., Madison County Public Library in Berea. Hispanic Outreach Project (HOP) offers ten-week Spanish course.

• Introduction to Computers - How to Use your Ipad, 4 p.m., Madison County Public Library in Berea. Must register -- 986-7112.

April 7• Aqua Zumba, 9 a.m., Berea College Seabury

Pool. Free, bring own towel.• Fit Club, 4 p.m., Berea Community School. Free

elementary age activities. • Aerobics, 5:35 p.m., Russel Acton Folk Center.

$3 per class, or 10 visit punch card for $25.• Jammin’ on the Porch, 7 - 9 p.m., Russel Acton

Folk Center. Bring instrument and join in the jam.


• Free afternoon movie, 3:30 p.m., Madison County Public Library in Berea. Showing Star Wars: The Force Awakens. Special snacks -- Wookie Cook-ies and Leia Buns.

April 7 - 9• Kinetic Expressions at Seabury Center. Berea

College presents their annual production of mod-ern dance, at 8 p.m. on April 7 & 8, and 2 p.m. on April 9. $7 admission; reserve by calling 985-3738. $5 suggested donation on April 9.

April 8• Free afternoon movie, 3:30 p.m., Madison

County Public Library in Berea. Showing Star Wars: The Force Awakens. Special snacks -- Wookie Cook-ies and Leia Buns.

April 8 & 9• All God’s Children Consignment Sale at Sand

Gap Christian Church. From 8 a.m. - 5 p.m. on Fri-day, and 8 a.m. - 3 p.m. on Saturday. Clothes, toys, furniture, books, or maternity clothes. Located on Hwy 421 in Sand Gap.

April 9• Berea Police Foot Pursuit 10K race and 5K fun

walk, 8 a.m., Berea Municipal Utilities parking lot. Will be benefiting Concerns of Police Survivors. More information at www.runberea.com.

• Fins and Feathers quilting demonstration, 10:30 a.m. - 3:30 p.m., Kentucky Artisan Center. Marilyn Foulke to demonstrate how she captures bird and fish species in her quilts.

• Dr. Cornel West from Union Theological Semi-nary to speak at bell hooks Institute for the series, Conversating: Black Men Speak. From 4 - 6 p.m. Limited seating, available at first come, first serve.


April 11• Darnell Moore, senior editor at MicNews, to

speak at bell hooks Institute for the series, Conver-sating: Black Men Speak. From 4 - 6 p.m. Limited seating, available at first come, first serve.








8:00 a.m.- 4:30 p.m.

BIG ONCOMMITMENT

AutoFarmHome


Business






Perhaps I can help.







Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



Branch ID#1027421



The Smith Group





April 8-10, 2016: Introduction to Throwing on the Potter’s Wheel, Teresa Cole, Instructor $100

April 9-10, 2016: Beginning Lamp Work Beads, Janie Miniard, Instructor $250

April 16, 2016: Fusing Glass 101, Janie Miniard, Instructor $85

April 16-17, 2016: Beginning Beaded Jewelry- Bracelet/Earring, Evelyn Schnee, Instructor $185

Four week class meeting each Wednesday in April: Digital Photography for the Everyday Person, Martha Wayland, Instructor $35




B6 The Berea Citizen Thursday, March 31, 2016Public Record


Marcy 25, 2016

March 19Rodney Hix, 39, Irvine,

public alcohol intoxicationLucy Cole-Smith, 25,

Waco, theft of identity of another without consent, failure to appear

Chad Riddell, 23, Irvine, theft by unlawful taking, contempt of court

Glenda Murray, 35, Rich-mond, giving officer false name or address, two counts of failure to appear

Priscilla Haddix, 27, Richmond, failure to ap-pear

Adam Croucher, 33, Berea, contempt of court

Billy Gadd, 26, Berea, two counts of failure to ap-pear

Chelsey Mattingly, 25, Richmond, public alcohol intoxication

Christopher Mullins, 32, Richmond, public alcohol intoxication, non payment of fines

March 20Brent Dalton, 29, Rich-

mond, serving bench war-rant for court

Leslie Foster, 52, Rich-mond, public alcohol in-toxication

Danielle Arnold, 28, Lan-caster disregarding traffic control device, operating motor vehicle under the in-fluence of alcohol or drugs

Serena Rader, 24, Lexing-ton, serving time

Zachary Crawford, 29, Somerset, operating motor vehicle under the influence of alcohol or drugs, posses-sion of open alcohol bever-age container in motor ve-hicle prohibited, resisting arrest, second degree dis-orderly conduct, receiving stolen property – firearm

Calvin Feltner, 45, Rich-mond, second degree forg-ery

Peter Porkka, 58, Rich-

mond, serving bench war-rant for court

Don Carter, 38, Rich-mond, theft by unlawful taking – shoplifting under $500

March 21Daniel Williamson, 19,

Richmond, public alcohol intoxication

Brendan Chapman, 19, Richmond. operating mo-tor vehicle under the influ-ence of alcohol – under 21 years of age

Jeffrey Robinson, 46, Richmond, parole viola-tion

Jacqueline Cain, 33, Rich-mond, failure to appear

Rachell Richardson, 31, Richmond, failure to ap-pear

Shirley Lane, 38, Berea, failure to appear

Josh Owens, 28, Rich-mond, failure to appear

Anthony Tuminski, 33, Richmond, serving bench warrant for court

Joshua Mills, 31, London, failure to appear

Arthur Cox, 41, Lexing-ton, hold for court

Ashley Cameron, 34, Lexington, operating mo-tor vehicle under the influ-ence of alcohol or drugs

Bobby Lawson, 56, Rich-mond, non payment of fines

Errich Schmidt, 26, Charleston, W.V., first degree rape, first degree sodomy, incest –forcible compulsion/incapable of consent or under 18 years old, first degree sexual abuse, prohibit use of elec-tronic communication sys-tem to procure minor

Terry Rawlins, 38, Rich-mond, fourth degree as-sault – domestic violence

Nathan Gibbs, 52, Rich-mond, public alcohol in-toxication

Helen Lucas, 43, Rich-mond, theft by unlawful taking – shoplifting under

$500Lucas France, 23, Rich-

mond, first degree pos-session of controlled sub-stance – heroin, buy/possess drug parapherna-lia, failure to appear

John McPhearson, 34, Richmond, receiving sto-len property $10,000 or more, buy/possess drug paraphernalia, failure to appear

Homer Brumley, 59, Berea, menacing, third degree assault – police or probation officer

James Hellard, 34, Mt. Vernon, fourth degree as-sault – domestic violence

Tina Ruark, 30, Rich-mond, fourth degree as-sault – domestic violence

March 22Travis Searcy, 37, Rich-

mond, fourth degree as-sault – domestic violence

Lindsey York, 30, Rich-mond, first degree pos-session of controlled sub-stance, contempt of court

James Cain, 65, Rich-mond, fourth degree as-sault – domestic violence

Wendy Smith, 42, Berea, receiving stolen property under $500

Nicholas Harrison, 32, Richmond, fraudulent use of credit card between $500 and $10,000

Quatisha Smith, 26, Rich-mond, probation violation

Brenda Taulbee, 33, Win-chester, parole violation

Amanda Dixon, 34, Rich-mond, parole violation

LaDonna Riddell-New-man, 35, Irvine, contempt of court

Jeremy Banks, 30, Rich-mond, public intoxication of controlled substance, theft by unlawful taking – shoplifting under $500, buy/possess drug para-phernalia

Anthony Clemmons, 32, Richmond, failure to ap-pear, third degree burglary,

second degree fleeing or evading police

Adlie Penman, 37, Rich-mond, hold for court

Michele Brown, 38, Rich-mond, receiving stolen property –firearm, theft by deception – include cold checks under $500, theft by unlawful taking – shoplift-ing under $50

Raymont Walker, 37, Lexington, contempt of court

Joseph Darbonne, 25, Gallatin, Tenn., flagrant non support

Rhonda Hurley, 34, Ir-vine, possession of mari-juana, theft by unlawful taking – shoplifting under $500

Christy Hamilton, 37, Richmond, third degree burglary

Holly Gross, 46, Rich-mond, non payment of fines

Raymond Baker, 38, Corbin, two counts of fail-ure to appear

William Beer, 32, Rich-mond, violation of a Ken-tucky EPO/DVO

March 23Sheila Osteen, 36, Wall-

ingford, parole violationWhitley Callahan, 26,

Mt. Sterling, violation of conditions of release

Amber Whiitamore, 24, Richmond, two counts of serving time

Kenneth Mitchell, 22, Lexington, second degree assault – domestic violence

Amanda Brewer, 32, Clay City, theft by unlaw-ful taking – shoplifting un-der $500, failure to appear, violation of conditions of release

Brian Best, 46, Richmond, contempt of court, non payment of fines, fraudu-lent use of credit card be-tween $500 and $10,000

Gaetana Shakur, 37, Berea, fourth degree as-sault -- domestic violence

Kayla Agee, 28, Rich-mond, failure to appear

March 24Maria Searles, 27, Rich-

mond, operating a motor vehicle under the influ-ence of alcohol or drugs, possession of open alcohol beverage container in mo-tor vehicle prohibited, no registration plates, failure of owner to maintain re-quired insurance

Jonathan Witt, 30, Rich-mond, contempt of court

Jeffery Ethridge, 26, Richmond, theft by un-lawful taking – between $500 and $10,000, failure to comply with sex offender registration

Justin Palmer, 22, Rich-mond, non payment of fines

Bobby Epps, 34, Moores-burg, Tenn., two counts of failure to appear, flagrant non support

Robert Moore, 27, Rich-mond, operating a motor vehicle under the influence of alcohol or drugs, no op-erators – moped license, failure of non-owner oper-ator to maintain insurance

Randall Burgess, 22, Berea contempt of court

Kayla Young, 24, Berea, first degree possession of controlled substance, pre-scription of controlled, substance not in proper container

Grant Graham, 34, Georgetown, improper registration plates, failure to wear seat belts, operat-ing on suspended or re-voked operator license, first degree possession of controlled substance, pre-scription of controlled sub-stance not in proper con-tainer

Aaron Gould, 32, Berea, failure to appear

Todd McManaway, 42, Elizabethtown, operating on suspended or revoked operator license, operat-

ing a motor vehicle under the influence of alcohol or drugs, possession of open alcohol beverage container in motor vehicle prohib-ited

Whitney Haley, 21, Rich-mond, failure to appear

William Lamb, 26, Rich-mond, driving on DUI sus-pended license

March 25Jeffrey Tarter, 21, Berea,

failure to appearJonathan King, 30, Dan-

ville, two counts of failure to appear

Brian Tipton, 31, Irvine, public intoxication of con-trolled substance

Gregory Hall, 24, Saly-ersville, failure to appear

Billy Raines, 54, Lily, fail-ure to appear

Kenneth Biggs, 31, Rich-mond, violation of condi-tions of release

Rodney Hamblin, 37, Williamsburg, failure to appear

Darren Parden, 30, Rich-mond, public alcohol in-toxication

David McNeal, 21, Rich-mond, operating motor ve-hicle under the influence of alcohol or drugs

Joseph McIntosh, 27, Richmond, fourth de-gree assault – domestic violence, second degree as-sault

Danny Callahan, 61, Richmond, first degree sexual abuse

Gregory Collins, 32, Berea, public intoxication of controlled substance, two counts of trafficking in controlled substance, buy/possess paraphernalia

Lymond Vanwinkle, 28, Richmond, two counts of first degree trafficking of controlled substance,, buy/possess drug para-phernalia

Jacklynn Barrett, 37, Berea, failure to appear


LWW Real Estate LLE, Douglas West, Patricia Ann Fletcher West, Julia West Ward, Ashley Ward, Vick-ie Yvonne West Maxwell, Robert David Maxwell, Jr., Aaron Ronald West, Lin-sey W. West, Mary Eileen Saunier West to Wireman Construction & Excavation LLC, Lots, North Street, $85,000

Jonathan D. Cross, Ash-ley Cross to Daniel Mead-ows, Tammy Meadows, Lot 118, Welchwood Sub-division in Berea, $125,000

TJA 6 LLC to Tony O’Dale Jean Malicote, Tiffany Malicote, 176 Hager Drive in Richmond, $89,000

Martha Wilson to Alyssa A. Howell, 169 Bryson Way in Richmond, $144,000

Luxon Contracting LLC to Tuan Pham, Bot Van, 132 Tuscany Way, $30,000

Wanda F. Murry to Jac-queline K. Moore, two tracts on the head waters of Muddy Creek, $180,000

Sharon Ezell to Menchie Bacani, 5006 Northern Dancer Drive in Rich-mond, $152,000

D. Gregory Jones, Kim-berly Ann Jones, Kimberly Ann Hall to Arline Flor-ence, Tract in Madison County, agreement be-tween the parties

Arline Florence to D. Gregory Jones, Kimberly Ann Jones, Kimberly Ann Hall, Tract in Madison County, agreement be-tween the parties

Michael D. Renfro, Phyl-lis Renfro to Lisa Owen, Tract in Madison County, $175,000

Brester Development Company LLC to Tommy Cope Properties LLC, Lot 154, Hidden Hills Subdivi-

sion, $12,000Brester Development

Company LLC to Tommy Cope Properties LLC, Lot 155, Hidden Hills Subdivi-sion, $12,000

Brester Development Company LLC to Tommy Cope Properties LLC, Lot 156, Hidden Hills Subdivi-sion, $12,000

Wilmington Savings Fund Society doing busi-ness as Christiana Trust not its individual capac-ity but solely as trustee for BCAC 20154-4TT to Waylon Isaacs, Darrell W. Isaacs, 246 Savanna Drive in Richmond, $205,000

Cynthia Ann Rogers to William Nation, Anita Nation, Lot 11, Greenhills Subdivision, $72,000

George Ernest McMa-kin, Sr., Linda Lou McMa-kin to Ralph J. Crawhorn, Sherri E. Crawhorn, Lot 35, Southern Hills, ½ mile south of Richmond, $175,000

Ralph C. Rose, Alma C. Rose to Raymond Rose, Carlista A. Rose, property at the intersection of Long Branch Road and Beech Grove Road, $5,000

Ingrid B. Schulberg to In-grid B. Schulberg, trustee, Ingrid B. Schulberg Revo-cable Trust, Lot 93, Deacon Hills Subdivision, funding the first party’s revocable trust

Joe Etta P. Byrd to Joe Etta P. Byrd, property near Richmond, love and affec-tion

Christopher Hager, Gra-cie Hager to Joey D. Cain, Krista Cain, Lot 64, Creek-side, $135,500

Robert A. Lafferty, Re-becca S. Lafferty to Karen H. Boardman, Robert R. Boardman, Lot 12, Woods Subdivision, $313,000

William Noah Noble to

Rachel E. Noble, 150 Jack Marie Drive in Richmond, $103,000

Vanwinkle Real Estate Holdings to Brandon J. Bet-ts, Lot 9, Lowery Heights in Richmond, $54,900

Joe Campbell to Wow Foodmart LLC, Lots 1 & 2 Redline Properties Inter-state Drive Subdivision in Richmond, $350,000

Jimmy Morgan, Evely-ene Morgan to Brian Bays, Sophie Bays, Lot 44, Creek-side Villages in Berea, $120,000

Wanda Jane Murray to Chad Chasteen, Amanda Chasteen, Tract, Madison County, $240,000

Jack Vanwinkle, Sr., Joyce Vanwinkle to Andrew Sim-mons, Tract in Madison County, $75,000

William H. Schutters to William H. Schutters, Carol E. Conyers, Lot 100 S. Bluegrass Junction, love and affection

Donnie Ray Adams, Bon-nie Jean Adams to Peoples Bank and Trust Company of Madison County, 1224 Mason Lake Road in Berea and 2919 Scaffold Cane Road in Berea, grantee re-fraining from its right to foreclosure

Robert Short, Sr., Nancy Marie Short, Joshua Bryan Sparks, Robert Shane Short to Shelby Joe Short, Sr., property on Ervin Slone Road, $5,000

James Roland Wright to Casey L. Boggs, 1022 Vineyard Way in Berea, $258,000

Ronald Carr, Judy A. Carr to Ronald Carr, Judy A. Carr, Tracts in Madison County, love and affection

Jeff Wilcox, Melissa Wil-cox to Donald Ray Estep II, Marsha Renee Estep, prop-erty off Igo Road, $18,000

Roy Todd Builders Inc.

to Ewtodd LLC, Lot 84, Banyans at Golden Leaf Subdivision, $116,500

Indigo Run Inc. to Robert McCollum, Gina McCol-lum, Lot 26, Berkley Hall Subdivision, $32,000

25 South Properties LLC to Justin Tyler Ross, Heath-er N. Ross, Lot 54, Crossing Subdivision, $148,661.60

Christine A. Wren to Wil-liam B. Mitchell, Michelle M. Mitchell, 101 Don-ald Drive in Richmond, $168,500

Beneficial Kentucky Inc., Altisource Solutions Inc., AIF to Chris Benezet, Tract, Carvers Ferry Road, $67,179

Clearview Apts LLC to James D. Shepherd, Vivian D. Shepherd, 100 Sham-rock Lane, 212 McDaniel Avenue, and 301, 305, 307, and 203 McDougal Ave-nue, distributing company assets to members

Timothy M. Coots, Amanda L. Coots to Wen-dell L. Coots, Tract at Kirksville Road, decree of dissolution

Wendell L. Coots to Rog-er D. Reynolds, Carol Ann Reynolds, Tract at Kirks-ville Road, $65,000

Dale Combs, Sara Kathy Combs to Eugene Styer, Debra Styer, 262 Waco Heights Drive in Waco, $20,000

Foleys Landing Inc. to Andrew Love, Mikeila Love, Lot 21, Rose Lawn Acres in Berea, $125,000

James Conley Saylor, Melissa Saylor to Doyle D. Yancey, Jr., Penny Yancey, 130 Circle Drive in Berea, $345,000

Stephen P. Virgin, Sheila E. Virgin to Jack Maupin, Edna Carol Maupin, Lot 52, Hartland Subdivision in Richmond, $90,000

Suanne T. Walsh, Walter

R. Walsh, Patricia T. Hob-son, David F. Hobson to Anita H. Marshall, Lots, Mountain View Subdivi-sion in Berea, $118,500

Erik S. Dunlap, Leslie

Ann Dunlap to Michael Douglas Reed, Cindy Yvonne Reed, Tract on W. Main Street in Richmond, $190,000


March 18Derrick Williams vs. Stephanie WilliamsMarch 21Anthony L. Calton vs. Lisa S. CaltonTiffany Young-Preston vs. James PrestonRhonda Cain vs. Kenton CainJoseph Welch vs. Yen HaAmanda Walters vs. Steven WaltersSamantha Hayes vs. Robert Hayes IIITimothy Anglin vs. Shaina AnglinWendi Shepherd vs. Kyle ShepherdCynthia Denny vs. Alonzo Denny, Jr.March 22Michael Ray Brooks vs. Jennifer Lynn Brooks (Howard)Connie D. Ishmael et al vs. Teresa Michelle DouglasAmanda Tackett vs. Johnathan L. TackettMarch 23Stephanie Joy Boggs vs. Jeff BoggsCabinet for Health and Family Services for Johnna L. Smith vs. Jerry L. SmithMarch 25Myrna Bostick vs. Russel Wayne BostickCabinet for Health and Family Services Ex Rel Heather Vandekieft vs. Eric D. Springborn

Domestic and Family cases filed in Madison Co. Circuit Court between March 18, 2016 to March 25,

2016: Cases may include divorce, child custody or support.



Foreclosures filed in Madison County Circuit Court between March 21, 2016 - March 25, 2016:

March 22Federal National Mortgage Association vs. Tony D. DavisMarch 23Caz Creek Kentucky, LLC vs. Jerry TurdorNationstar Mortgage LLC vs. Nadine E. CroleyMarch 24Pennymac Loan Services LLC vs. Larna Durham

“And time yet for a hundred indecisions, And for a hundred visions and revisions,

Before the taking of a toast and tea.”-- T.S. Eliot,

“The Love Song of J. Alfred Prufrock”

I haven’t always been a librar-ian. Once upon a time, I worked in the literary arts, creating, collabo-rating, and cultivating writing and writers across Kentucky and be-yond. Poetry readings, open mics, workshops, performances, liter-ary journals, short story contests, anthologies, even summer camps and after school programs were the focus of my daily work. And I loved it – loved the im-mersion in the cacophony of cre-

ative voices, loved the drama and the beauty of it all. I discovered early on that I loved writing and I loved writers. Becoming a librar-ian seemed a natural outgrowth of that love. But somewhere between love and reality, I lost touch with my “writerly” (to borrow a phrase from Kentucky writer Jim Wayne Miller) self. As strange as it may sound, even surrounded by books and writing every single day of my life, I be-came disconnected from writers. But time has a way of looping back around at odd moments, and several months back, I came face to face with an old friend: writing. Writing that builds community. Writing that links our shared ex-perience on this planet. Writing that defines and redefines and shatters and recreates who we are as humans. It was KY Poet Laureate George Ella Lyon’s massive statewide partnership project with the KY Arts Council – “Where I’m From: A Poetry of Place” – that recon-nected me. As the Madison Coun-ty Public Library served as a facili-tator and poem gatherer for our county, I suddenly found myself in the company of writers again. All of a sudden, I was at poetry

workshops, and people were shar-ing their work, and words were curling down blank pages like a fast-growing vine. We have now passed the first stage of gathering poems from lo-cal writers (I sent 66 pages of po-ems to the KAC to post on their site for KY Writers Day on April 25). The project has proven so popular that George Ella recently announced it would continue through the end of her Poet Laure-ate term at the end of this year. The second stage involves shar-ing and celebrating the work. The poems collected will be on the KAC website and will be archived by the University of Kentucky’s Special Collections. Writers from across the state will gather in Frankfort at the Capitol on April 25 for KY Writers Day. And we will celebrate locally with a com-munity event on April 11 at 7 PM at the Loyal Jones Appalachian Center at Berea College. “Madison County, Kentucky’s Where I’m from: A Poetry of Place” is a multidisciplinary celebration of our community identity. Berea College students and community members will share work from the project, and the event is free and open to the public. During my process of repatria-

tion with writing, I have recon-nected with two long-time writer friends who are also Appalachian Center associated faculty – Silas House, the NEH Chair in Appala-chian Studies, and Crystal Wilkin-son, Appalachian Writer in Resi-dence. MCPL is currently making plans with Silas to feature his nov-el, Eli the Good, in a multi-county community reading program this fall. He has a new book coming out in 2017. Crystal’s novel, The Birds of Op-ulence, was released earlier this month by the University Press of Kentucky, and it is quite stunning. I was able to attend the book re-lease at her Lexington book store, Wild Fig Books & Coffee, a few weeks ago, and she read the first chapter aloud to a packed house. I was mesmerized. This is a book to savor. I usually speed read books, but I enjoyed this a chapter a day, letting the story and the images settle in and mellow. We have sev-eral copies available for check-out at the library. Crystal Wilkinson will be one of the authors featured at the Berea Book Fest at the MCPL Berea lo-cation from 10 AM-2:30 PM on Saturday, April 16. A joint project with the Berea Writers Circle, Ro-bie Books, and the library, this sec-

ond annual event features a whole day of public readings and author signings. Joyce Hunsucker from the Berea Writers Circle says she is excited about this second year of the event and the opportunity to continue introducing the community to new authors and creating a space for authors to share their work with the community. She says the event strives to feature new authors each year, and this year, the work of children’s authors has been added. Authors scheduled to appear at this year’s Berea Book Fest include Crystal Wilkinson, Nancy Jen-sen, Carter Sickels, Ed Ford, Julie Hensley, Tasha Cotter, Lucas Mc-Williams and Sophia McWilliams, Rebecca Patrick-Howard, Melinda Richardson and Julia Richardson, Jereme Zimmerman, Brandon Thompson, Laura Frantz, Marie Mitchell and Mason Smith, Gail Nall, Joshua Gray, Tina Parker, Vicky Hayes, and Barbara Wade. The event is free and open to the public. I hope you will visit the library soon and reconnect with your writerly self or even discover a new author. I’ll see you soon!


Shelf Notes

Ruthie Maslin,

Madison Co. Library

Librarian reconnects with former life as a writer

Madison County Public Library

Calendar of EventsBerea location

Berea319 Chestnut St.Berea, KY 40475P. 859-986-7112F. 859-986-7208

Richmond507 W. Main St.

Richmond, KY 40475P. 859-623-6704F. 859-623-2032

www.madisonlibrary.org

Check us out on Facebook for even

more up-to-date information!


Reflections

FROM THE BEREA CITIZEN ARCHIVES MARCH 1976

Usually we report on March incidents from old

issues of the Citizen for our Reflections section, but this week, we bring you Berea memories from one of our

readers.

Remembering BereaBy Mary M. Allen

Does anyone remem-ber when gasoline was 19 cents a gallon?

Bread was 5 cents a loaf?When postage stamps to

mail a letter were 3 cents? And a postcard was 1 cent?

When you hitched your horse and buggy to a hitch-ing post on Main Street?

When Walter Engle had a clothing store on Chest-nut Street? It was where Steve Connelly has his law office now.

When Bill Malicote had a

service station on the cor-ner of Chestnut and Boone Street?

When Rev. O. B. Mylum was pastor of Berea Baptist Church?

When Purkey’s was the only supermarket in Berea?

When Henry Todd had a junk yard – car parts etc.?

When Scott Seals had a theater – you could go see a movie for 25 cents, and popcorn was 5 cents?

Ogg Studio, Porter Moore Drug Store, Lucas Tourist Home where Berea Bank is now. Eplees Tour-ist Home – G & M Cafe?

Little Mama’s Tea Room on Short Street?

I remember when a fallen hero would arrive in Berea at the train sta-tion. Lots of people would gather to meet them. The train would blow a long,

sad signal upon the ar-rival of a father, son, hus-band, sweetheart. They would come home in a flag draped casket. High re-spect was shown to them.

Does anyone remem-ber the celebration when WWII was over? Bells ringing, horns sounding, people yelling, it was a very exciting time.

Does anyone remem-ber when an older lady named Henrietta Childs would come to the coun-try schools, and tell stories to the children. She wore a black cape, was sort of bent over. She would have a shoebox with little toys, birds, dolls, etc. all wrapped in tissue pa-per. She would keep us children spellbound for a whole afternoon. She would make noises like the animals, and make the

birds fly, etc. Such precious childhood memories.

When you heard a car coming up or down the road, we would run to the road to see it go by, per-haps even chase after it.

Who remembers bal-lerina skirts, pony tails, bobby socks, saddle ox-ford shoes? They would be black or brown with white.

Bubble gum, when you could buy 1 cent candy, when we walked to and from school?

There was no TV, and few telephones.

Revivals in country churches would last two weeks or more; every night the visiting preacher would preach hell, fire, and brimstone. People would listen to the word of God and many would change their ways of living.

When you hung your

clothes on the clothesline to dry? There were no elec-tric lines through the coun-try. When you had a hand pump in the kitchen for water supply, which came from a well or spring.

When US 25 was the only major highway through Kentucky? When I-75 came through Berea? When Lucy Cummins would tell your fortune?

When Muncy’s had a lumber company?

When Ellis Pitts had a used furniture company on Adams and Broadway Street?

Winner Hotel – Lincoln Hotel.

When Nellie Bales taught piano lessons?

Who remembers Dave Carter pushing a wheel-barrow everywhere he went in Berea? Who re-members Elijah “Lige”

Williams?Who remembers Model

A cars? Model T. Ford?Who remembers when

everyone grew a vegetable garden, grew their own food? Canned it in glass jars for winter. When doc-tors came to your home to deliver a baby, and would have a black bag with his tools in it. He would come in a horse and buggy.

My dad walked seven miles a day to go to work on the W.P.A., got paid $1.25 an hour. He would leave home before day-light, carrying a kerosene lantern, and work all day building the Menelaus Pike. He would get home after dark, through rain, snow, heat, sleet, whatever the weather offered.

Those were the good old days to remember.


On Tuesday, April 5, traditional singer and banjo player Sara Grey will give a free concert at the Berea College Loyal

Jones Appalachian Center. Grey is internationally known for her

singing of traditional ballads, her claw-hammer banjo playing and her abilities as a teacher and storyteller. Originally from New Hampshire, Grey has lived in Ar-kansas, North Carolina, Ohio, Montana, New York, Pennsylvania, Arizona, Scot-land and England, and all of these places have informed her music.

In this special Berea concert, Grey will lead the audience on a musical journey, following the old songs from their ori-gins in the British Isles and down through generations of singers in the Appalachian mountains. The concert will be held from 7-9 p.m. at the Loyal Jones Appalachian Center. Admission is free and open to the public. Doors will open at 6:30 p.m. and no reservation is required.

Brian Peters wrote, “In Sara’s perfor-mance, the art of the singer and that of the storyteller merge to produce a web of tales and songs capable of transporting an

audience from the concert hall to the inti-macy of a kitchen fireside.”

Grey describes her singing as “a love affair with traditional songs for over 60 years,” a pursuit which has earned her a wealth of knowledge concerning these ballads and how they have moved and evolved. Grey has recorded numer-ous albums, including sev-eral with her son, guitarist and singer Kieron Means, and Sara was recently fea-tured in the book Wayfaring Strangers: The Musical Voy-age from Scotland and Ul-ster to Appalachia by Fiona Ritchie and Doug Orr.

The Loyal Jones Appala-chian Center is located on the Berea College campus in Stephenson Hall, 205 North Main Street. This

concert is co-sponsored by Berea Tourism, the Berea College Music Department and the Loyal Jones Appalachian Center.

Singer, Banjo Player, & Storyteller to Give Free Concert

Local News



WelcomeDAVID



We Offer• FREE Vitamins




Open 9 - 6 Mon.- Fri. 9 - 1 on Saturday



Mitchell Tolle

Tater Knob Pottery






Don’tmiss it!



00859-986-3301222 E Haiti Rd.

COPE’S Garage

Honoring Artists & Their Patrons

Documents

Transcript of Honoring Artists & Their Patrons