Petunjuk Praktis Terapi Insulin 2011 Launching

download Petunjuk Praktis Terapi Insulin 2011 Launching

of 37

  • date post

    29-Oct-2015
  • Category

    Documents

  • view

    2.867
  • download

    74

Embed Size (px)

description

Petunjuk Praktis Terapi Insulin 2011 Launching

Transcript of Petunjuk Praktis Terapi Insulin 2011 Launching

  • PETUNJUKPRAKTIS

    TERAPIINSULINPADAPASIENDIABETESMELITUS

    PerkumpulanEndokrinologiIndonesiaPERKENI2011

  • KATA PENGANTAR Saat ini ilmu pengetahuan dan teknologi di bidang terapi insulin semakin berkembang. Hal ini membuat penggunaan insulin semakin aman, nyaman dan mudah. Dalam rangka mencapai target kadar glukosa darah yang mendekati nilai normal, klinisi dapat memberikan insulin sebagai pilihan sesuai indikasi. Keuntungan insulin yang lain adalah mencegah komplikasi diabetes di kemudian hari. Penggunaan insulin dalam kehidupan sehari-hari oleh para penyandang diabetes melitus telah dipermudah dengan kemajuan ilmu pengetahuan dan penemuan alat-alat bantu penyuntikan, serts jenis-jenis insulin baru. Di rumah sakit, tempat spesialis penyakit dalam dan konsultan endokrin metabolisme dan diabetes memegang peranan penting, penggunaan insulin disesuaikan dengan perkembangan ilmu kedokteran. Pengurus Besar Perkumpulan Endokrinologi Indonesia (PB PERKENI) periode tahun 2010-2012 membentuk tim khusus yang diketuai oleh Prof. Dr. dr. Ketut Suastika, SpPD KEMD, untuk mempelajari, menilai, dan mengkaji penggunaan insulin dalam klinik. Dalam buku ini dijelaskan mekanisme kerja insulin, temuam beberapa insulin baru, kelebihan dan kekurangan berbagai jenis insulin, tehnik penyuntikan yang lebih baik, pemanfaatan insulin dalam klinik, serta pemantauan hasilnya. Buku ini diharapkan dapat menjadi petunjuk bagi para dokter spesialis penyakit dalam, para konsultan endokrin metabolisme dan diabetes, serta spesialis lain sesuai kewenangan klinik dalam melaksanakan tugasnya. Dalam rangka untuk memaksimalkan manajemen kendali glukosa darah pada pasien diabetes maupun pada kondisi selain diabetes yang mengalami hiperglikemia. Bagi tenaga kesehatan lainnya, buku ini diharapkan dapat memberikan gambaran umum penggunaan insulin yang baik dan benar baik dalam pelayanan rawat jalan maupun rawat inap. Hal ini dapat memberikan manfaat bagi perbaikan kualitas pelayanan kesehatan dan dapat menurunkan angka morbiditas dan mortalitas. Buku petunjuk ini merupakan salah satu buku konsensus yang diterbitkan berdasarkan pengkajian, penilaian, dan telaah kritis PERKENI terhadap berbagai laporan penelitian di bidang endokrinologi secara umum khususnya masalah diabetes melitus. PB PERKENI mengucapkan terima kasih kepada semua pihak yang membantu perencanaan, persiapan, dan pelaksanaan program pembuatan konsensus ini. Untuk evaluasi selanjutnya kami tetap membuka pintu untuk masukan-masukan baru untuk lebih menyempurnakan buku ini. Selamat membaca dan menerapkan dalam praktik! dr. Pradana Soewondo, SpPD KEMD Ketua PB PERKENI

  • DAFTAR ISI I. PENDAHULUAN 1 II. FARMAKOKINETIK OBAT INSULIN 3 III. EFEK INSULIN DAN MANFAAT TERAPI INSULIN 6 III.A Efek Insulin 6 III.B Hiperglikemia Sebagai Petanda Luaran Klinik 7 III.C Manfaat Terapi Insulin 8 IV. TERAPI INSULIN UNTUK PASIEN DIABETES MELITUS RAWAT JALAN 9 IV.A Indikasi Terapi Insulin 9 IV.B Konsep Insulin Basal dan Insulin Prandial 9 IV.C Memulai dan Alur Pemberian Terapi Insulin 10 IV.D Strategi Praktis Terapi Insulin 13 IV.E Cara Pemberian Insulin 16 IV.F Sasaran Terapi 16 V. TERAPI INSULIN UNTUK PASIEN HIPERGLIKEMIA YANG

    DIRAWAT DI RUMAH SAKIT 19 V. A Terapi Insulin Pasien Rawat Inap 19 V. B. Terapi Insulin Intensif Pada Pasien Kritis 20

    VI. TERAPI INSULIN PADA PASIEN PERIOPERATIF 23 VII. TERAPI INSULIN PADA KETOASIDOSIS DIABETIK DAN

    STATUS HIPERGLIKEMIA HIPEROSMOLAR 25 VIII. KEAMANAN DAN EFEK SAMPING INSULIN 28

    VIII.A. Penggunaan Pada Wanita Hamil 28 VIII.B Hipoglikemi 28 VIII.C Peningkatan Berat Badan 28 VIII.D Edema Insulin 29 VIII.E Lipoatrofi dan Lipoohipertrofi 29

    IX TEHNIK PENYUNTIKAN DAN PENYIMPANAN INSULIN 30 IX.A Tehnik Penyuntikan Insulin 30 IX.B Tehnik Penyimpanan Insulin 31 DAFTAR PUSTAKA 32

  • 1

    I. PENDAHULUAN

    Ditemukannya insulin hampir 90 tahun yang lalu merupakan salah satu tonggak sejarah

    terbesardalambidangkedokteranpadaabadke20.Sangatpantaskemudianpenemunya

    mendapatkan hadiah nobel di bidang kedokteran. Dalam kurunwaktu yang tidak terlalu

    lama,terutamadalam20tahunterakhirtelahbanyakkemajuandalamterapiinsulin.Mulai

    daripemurnian sediaan insulin (dari insulinpolikomponenmenjadimonokomponenyang

    berasaldari insulinbinatang)hinggaditemukannya insulinmanusiadengancara rekayasa

    genetik serta yang terakhir adalah ditemukannya insulin analog. Kemajuan terapi insulin

    juga terletak pada konsep sekresi insulin endogen, pola alamiah sekresi insulin, yang

    membawa perbaikan di dalam perbaikan konsep terapi insulin. Dengan adanya insulin

    analog,makinmendekatkan terapi insulinyangmenyerupaipola sekresi insulinendogen,

    sehinggahasilpengobatanmenjadilebihbaikdanmenurunkanefeksamping.

    Diabetesmerupakan penyakit yang progresif, jika tidak dikelola dengan baikmaka cepat

    jatuhpadakomplikasikhususnyapenyakitpembuluhdarah.Secaragarisbesarada2 tipe

    diabetes yang utama, yaitu diabetes melitus tipe 1 (DMT1) dan diabetes melitus tipe 2

    (DMT2). DMT1 merupakan diabetes yang disebabkan oleh karena kerusakan sel beta,

    sehingga terjadi kegagalan fungsi sel beta dalam mensekresikan insulin secara mutlak.

    Pasien seperti ini memerlukan insulin untuk hidupnya. Mekanisme DMT2 umumnya

    didahului oleh resistensi insulin dan akhirnya akan terjadi disfungsi sel beta untuk

    mencukupikebutuhaninsulinendogen.DemikianjugayangterjadipadaDMT2.Meskipun

    padapasienDMT2belumterjadikekurangan insulinendogenyangmutlak,namundalam

    perjalanannya sebagian besar akan membutuhkan insulin untuk mengendalikan glukosa

    darahnya.

    Pengetahuan dasar mengenai terapi insulin penting diketahui oleh semua dokter,

    diantaranyameliputi jenis, farmakokinetik, rejimen,keuntungan,kendala,keamanan,dan

    efek samping penggunaan insulin. Keuntungan penggunaan insulin adalah bahwa insulin

    merupakan obat alamiah (suplemen insulin endogen) dan dapat digunakan menyerupai

    pola sekresi insulin endogen oleh sel beta, serta dosisnya tidak ada batasnya. Kendala

    utama dari terapi insulin adalah karena bentuknya masih dalam bentuk suntikan dan

    harganyarelatiflebihmahaldibandingkanobathipoglikemikoral.Walaupunparaahlitelah

    berusahameneliti sediaan bukan suntikan, seperti inhalan, tempelan di kulit, dan tablet,

  • 2

    namun kenyataannya baru bentuk suntikan yang sudah sempurna dan tersedia di

    Indonesia.

    Bukukonsensusinidapatdigunakansebagaipanduanbagidokterspesialispenyakitdalam,

    konsultan endokrin, dan spesialis lainnya dalam pengelolaan pasien diabetes yang

    membutuhkan insulin. Sedangkan untuk memulai terapi insulin pada pasien diabetes

    melitus tipe 2 di tingkat layananprimer dapat digunakanpanduanpadabukuKonsensus

    PengelolaandanPencegahanDiabetesMelitusTipe2.

  • 3

    II. FARMAKOKINETIKOBATINSULIN

    Insulinmerupakanobat tertua yangdigunakanuntukpengobatandiabetes, yakni sejak tahun

    1922.Insulinjugamerupakantonggaksejarahyangamatfenomenaldalambidangkedokteran.

    Awalnyainsulindibuatdariekstrakbinatang,sepertibabidansapi.Kemudiandengankemajuan

    teknologi berhasil dibuat insulin manusia dengan teknologi rekayasa genetik yang kemudian

    dipasarkan pada tahun 1980an. Seiring perjalanan waktu, insulin sebagai terapi terus

    dikembangkan dengan harapan kerjanya dapat menyerupai insulin endogen. Sehingga pada

    pertengahantahun1990andiperkenalkaninsulinanalogpertamadengankerjacepat.

    Saatinidipasarantersediaberbagaijenisinsulin.Ditinjaudariasalnya,terdapatinsulinmanusia

    dan insulin analog (sudah direkayasa dengan kerja yang lebih baik dari insulin manusia).

    Sedangkanbiladitinjaudari segikerjanyaterdapat insulinkerjapendek (insulinmanusia)atau

    cepat (insulin analog), kerja menengah (insulin manusia), dan kerja panjang (insulin analog).

    Insulinkerjapendekataucepatseringdisebutdenganinsulinprandialkarenadigunakanuntuk

    menurunkan glukosa darah setelah makan, sedangkan insulin kerja menengah dan panjang

    seringdisebutinsulinbasalkarenadigunakanuntukmenurunkanglukosadarahdalamkeadaan

    puasa dan sebelum makan. Selain itu di pasaran juga tersedia insulin campuran (premixed).

    Insulin campuran ini merupakan campuran antara insulin kerja pendek dan kerja menengah

    (insulin manusia) atau insulin kerja cepat dan kerja menengah (insulin analog). Umumnya

    campurantersediadenganperbandingantetapantarainsulinkerjapendekataucepatdankerja

    menengah(25%:75%atau30%:70%).

    Mengenal farmakokinetik setiap insulin yang tersedia adalahwajib bagi dokter dalam praktik

    seharihari.Halinibertujuanagarsetiapdokterdapatmemanfaatkaninsulindenganbaiktanpa

    efeksampingyangserius.Yangperludiketahuiterkaitfarmakokinetikinsulinadalahawalkerja,

    puncak kerja, dan lama kerja. Sesuai dengan karakteristiknya, setiap insulin dapat dipilih dan

    digunakan sesuai dengan kebutuhan pasien. Jenis dan profil kerja insulin dapat dilihat pada

    Tabel II.1sedangkanperbandinganfarmakokinetikberbagai insulineksogendapatdilihatpada

    GambarII.1.

  • 4

    TabelI.1.Farmakokinetiksediaaninsulin

    ProfilKerja(jam)

    InsulinManusiaatauInsulinAnalog Awal Puncak

    Kerjacepat(insulinanalog)

    Insulinlispro(Humalog)

    Insulinaspart(Novorapid)

    Insulinglulisin(Apidra)

    0,20,5

    0,20,5

    0,20,5

    0,52

    0,52

    0,52

    Kerjapendek(insulinmanusia,insulinreguler)

    HumulinR

    Actrapid

    0,51

    0,51

    Kerjamenengah(insulinmanusia,NPH)

    HumulinN

    Insulatard

    1,54

    410

    Kerjapanjang(longinsulinanalog)

    Insulinglargine(Lantus)

    Insulindetemir(Levemir)

    13

    Hampirtanpa

    puncak

    Campuran(premixed,insulinmanusia)

    70/30Humulin(70%NPH,30%reguler)

    70/30Mixtard(70%NPH,30%reguler)

    0,51

    312

    Campuran(premixed,insulinanalog)

    75/25Humalog(75%NPL,25%lispro)

    70/30Novomix(70%protamineaspart,30%aspart)

    0,20,5

    0,20,5

    14

    14

    NPH,neutralprotamineHagedorn;NPL,neutralprotaminelispro.DimodifikasidariMooradian

    et al. Ann Intern Med 2006; 145: 12534. Nama obat disesuaikan dengan yang tersedia di

    Indonesia

  • 5

    GambarII.1.Profilfarmakokinetikinsulinmanusiadaninsulinanalog.

    Tampakawaldanlamakerjarelatifberbagaijenisinsulin.Lamakerjanyabervariasiantardan

    intraindividu.HirshIB.NEnglJMed2005;352:17483

  • 6

    III. EFEKINSULINDANMANFAATTERAPIINSULIN

    A. EfekInsulin

    Sudah lama diketahui bahwa insulin mempunyai efek metabolik terhadap metabolisme

    karbohidrat, lipid dan protein. Secara umum insulin bersifat anabolik, yang diantaranya

    berfungsiuntukmemasukkanglukosakedalamseldanmencegahpelepasanglukosaolehhati,

    mencegahlipolisis,danmeningkatkansintesisprotein.

    Kini,insulintidaksajadikenalmempunyaiefekmetabolismesepertidiatas,namunjugaterlibat

    dalam berbagai efek di dalam tubuh. Insulinmempunyai efek antiinflamasi denganmenekan

    faktortranskripsiproinflamasisepertinuclearfactor(NF)kB,Egr1,danactivatingprotein1(AP

    1). Di dalam tubuh, insulin menekan NFkB binding activity, terbentuknya spesies oksigen

    reaktif, kadar intercellular adhesion molecule1 dan monocyte chemotactic protein1,

    matrixmetalloproteinase9, tissue factor (TF), PAI1, interleukin (IL)1b, IL6, macrophage

    migrationinhibitionfactor(MIF),dantumornecrosisfactor(TNF)a.Disampingitu, insulinjuga

    mempunyaiefekantiapoptosis,protektif terhadap jantung.Efek insulinyang laindanmanfaat

    pemberianinsulindapatdilihatpadaGambarIII.1.

    Gambar III.1. Efek baru insulin dengan sasaran sel endotel, platelet, dan leukosit yang

    menghasilkanvasodilatasi,antiagregasiplatelet,efekantiinflamasi,danefekterkait lainnya.

    DandonaPetal.Circulation2005;111:144854.

    Efek Biologis Lain Insulin

  • 7

    B. HiperglikemiaSebagaiPetandaLuaranKlinik

    Hiperglikemiapadapasienyangdirawatdirumahsakitmerupakankeadaanyangcukupsering

    ditemukan. Kadar glukosa darah yang tinggi merupakan keadaan yang serius, walaupun

    sebelumnya tidak ditemukan riwayat diabetes. Adanya hiperglikemia merupakan petanda

    pentingburuknyaluaranklinis(morbiditasmaupunmortalitas)pasien,baikdenganatautanpa

    riwayatdiabetes sebelumnya.PenelitianUmpierrezetal. (2002)merupakancontohyangbaik

    bagaimanahubunganantarahiperglikemiadenganluaranklinikbagipenderitayangdirawatdi

    rumahsakit.Penelitianretrospektiftersebutmenunjukkanbahwapasienyangdirawatdirumah

    sakit dengan hiperglikemia yang baru terdiagnosis mempunyai angka mortalitas yang lebih

    tinggi dibandingkan dengan pasien yang telah diketahui menderita diabetes dan pasien

    normoglikemia(GambarIII.2).

    Gambar III.2 Persentase mortalitas pasien yang dirawat di rumah sakit dengan

    normoglikemia,diabetesyangtelahdiketahui,danhiperglikemiayangbaruterdiagnosis,baik

    yangdirawatdibangsalmaupundiruangrawatintensif.

    Umpierrezetal.JClinEndocrinolMetab2003;87:97882,.

    Hiperglikemia berdampak buruk terhadap luaran klinis karena dapatmenyebabkan gangguan

    fungsi imun sehingga lebih rentan terhadap infeksi, perburukan sistem kardiovaskuler,

    trombosis, peningkatan inflamasi, disfungsi endotel, stres oksidatif, dan kerusakanotak. Stres

    oksidatifmerupakan keadaan yang sering ditemukan pada diabetes dan diduga sebagai salah

    satu penyebab penting dalam terjadinya komplikasi diabetes. Hiperglikemia akut dapat

    menyebabkanstresoksidatifdanpeningkatangenerasistresoksigenreaktifakanmengaktifkan

    faktor transkripsional, faktor pertumbuhan, dan mediator sekunder. Melalui jejas jaringan

    secara langsung ataumelalui aktivasi mediator sekunder, stres oksidatif akibat hiperglikemia

    menyebabkanjejasseldanjaringan(GambarIII.3).

  • 8

    GambarIII.3. Hubunganantarahiperglikemiadanburuknyaluaranrumahsakit.

    ALB=asamlemakbebas.Clementetal.DiabetesCare2004;27:55391

    c.ManfaatTerapiInsulin

    Berdasarkan berbagai hasil uji klinik, terbukti bahwa terapi insulin dapatmemperbaiki luaran

    klinik pada pasien dengan hiperglikemia. Hal ini dapat dimengerti karena insulin, di samping

    dapatmemperbaikistatusmetabolikterutamaperbaikankadarglukosadarah,jugamempunyai

    efeklainyangmenguntungkanbagipasien,sepertidiuraikandiatas.

    Infus insulin (glukosainsulinkalium) terbukti dapat memperbaiki luaran klinik pasien gawat

    yang dirawat di ruang terapi intensif akibat penyakit jantung atau stroke. Hal ini terutama

    disebabkanolehpenurunanangkakejadiangagalorganmultipelakibatsepsis.Padapasienkritis

    bedah yang dirawat di ruang terapi intensif dengan hiperglikemia juga menunjukkan luaran

    klinik seperti mortalitas di rumah sakit secara keseluruhan, sepsis, gagal ginjal akut yang

    membutuhkandialisis atauhemofiltrasi, transfusi sel darahmerah,polineuropati, penurunan

    penggunaan ventilasi mekanis yang berkepanjangan, dan lama perawatan di ruang terapi

    intensif.

    Ujiklinikbelakangan,menunjukkanbahwakendaliglukosadarahyangterlaluketatpadapasien

    kritisataugawatmedikyangdirawatdiruangterapiintensifmenunjukkankematianyanglebih

    tinggi. Hal ini dikaitkan dengan kejadian hipoglikemia yang lebih sering terjadi pada pasien

    dengan sasaran glukosa darah yang lebih ketat. Buruknya luaran bukan dikaitkan secara

    langsungdenganterapiinsulin,namunterletakpadasasaranterapi.

  • 9

    IV.TERAPIINSULINUNTUKPASIENDIABETESMELITUSRAWATJALAN

    A. IndikasiTerapiInsulin

    Diabetes merupakan penyakit yang progresif, di mana tanpa pengelolaan yang baik pasien

    mudahmendapatkankomplikasiakutdankronik.Kendaliglikemikyangburukmerupakansalah

    satu penyebab terpenting terjadinya komplikasi. Karenanya dibutuhkan strategi terapi yang

    lebihagresifagarkendaliglikemikyangbaikdapattercapai,baikdenganobathipoglikemikoral

    (OHO)ataukombinasiOHOdaninsulin(padapasienDMT2),maupundenganterapiinsulinsaja

    (misalnyapasienDMT1atauDMT2).

    TabelIV.1.Indikasiterapiinsulin

    IndikasiMutlak

    DMT1

    IndiasiRelatif

    GagalmencapaitargetdenganpenggunaankombinasiOHOdosisoptimal(36bulan)

    DMT2rawatjalandengan:

    Kehamilan

    Infeksiparu(tuberkulosis)

    Kakidiabetikterinfeksi

    Fluktuasiglukosadarahyangtinggi(brittle)

    Riwayatketoasidosisberulang

    Riwayatpankreotomi

    Selainindikasidiatas,terdapatbeberapakondisitertentuyangmemerlukanpemakaianinsulin,

    sepertipenyakithatikronis,gangguanfungsiginjal,danterapisteroiddosistinggi

    B. KonsepInsulinBasaldanInsulinPrandial

    Pada orang normal, jumlah insulin yang disekresi oleh sel beta (insulin endogen) terutama

    dipengaruhiolehkeadaanpuasadanmakan.Padakeadaanpuasaatausebelummakan,selbeta

    mensekresiinsulinpadakadartertentuyanghampirsamasepanjangwaktupuasadansebelum

    makan.Konsepinidisebutdenganinsulinbasal,yangbertujuanuntukmempertahankankadar

    glukosadarahpuasaatausebelummakanselaludalambatasnormal(padaorangnormalkadar

    glukosa darah dibawah 100 mg/dL). Pada setiap kali makan (makan pagi, makan siang, dan

    makanmalam)ketikaglukosadarahnaikakibatasupandari luar,dibutuhkansejumlah insulin

    yangdisekresikanolehselbetasecaracepatdalamkadaryanglebihtinggiuntukmenekankadar

  • 10

    glukosa darah setelah makan agar tetap dalam batas normal (tidak lebih dari 140 mg/dL).

    Konsep ini disebut insulin prandial (setelah makan) yang bertujuan untuk mempertahankan

    kadarglukosadarahsetelahmakantetapdalambatasnormal.

    Padaorangdiabetes,baikDMT1maupunDMT2,terjadikekuranganbaik insulinbasalmaupun

    insulin prandial endogen. Berdasarkan konsep ini, sedian insulin eksogen disesuaikan dengan

    kebutuhansepertihalnyapadaorangnormal,yaituinsulinbasal(yangbekerjamenengahatau

    panjang) dan insulin prandial (yang bekerja pendek/cepat). Insulin basal eksogen umumnya

    diberikansebanyak1sampai2kalisehari,sedangkaninsulinprandialeksogendiberikansetiap

    kalisebelummakan.

    C. MemulaidanAlurPemberianTerapiInsulin

    C.1.DiabetesMelitusTipe1

    SemuapasienDMT1diberikanterapiinsulinbegitudiagnosisditegakkan.Karenapadapasienini

    ditemukan kekurangan insulin secara mutlak, maka seluruh kebutuhan insulin tubuh harus

    diganti dari luar. Prinsipnya, padaDMT1 terjadi kekurangan insulin endogen baik basal (pada

    saat puasa atau sebelum makan) maupun prandial (setelah makan); oleh karena itu terapi

    insulinyangdiberikanharusmengandungduakomponeninsulintersebut.Disampingitu,agar

    sesuaidenganpolasekresiinsulinendogen,makaterapiinsulinwajibdiberikanmultipelsesuai

    denganjadwalmakan.Untukmenurunkankadarglukosadarahsetelahmakandigunakaninsulin

    prandialdanuntukmempertahankankadarglukosabasaldigunakaninsulinbasal.

    Pada umumnya, dosis insulin yang diberikan pada pasien DMT1 yang baru adalah 0,5

    unit/kgBB/hari.Kemudiandosisinsulinhariantotalberdasarkanperhitunganini,dibagimenjadi

    60% bagian yang diberikan dalam bentuk insulin prandial (selanjutnya dibagi tiga, diberikan

    sebelummakanpagi,makansiangdanmakanmalam)dan40%bagiandiberikandalambentuk

    insulin basal padamalam hari. Insulin basal yang bekerja intermediet jika diberikan satu kali

    sebaiknyadiberikanmalamhari,namundemikianjugabisadiberikanduakalisehariyaitupagi

    dan malam hari. Untuk insulin basal yang bekerja panjang (mendekati 24 jam) dapat juga

    diberikan pada pagi hari, yang pentingwaktunya tetap. Contoh perhitungannya terlihat pada

    GambarIV.1.

  • 11

    GambarIV.1.MemulaiterapiinsulininjeksimultipelharianpadapasienDMT1.

    ChengandZinman,JoslinsDiabetesMellitus,2005.

    Walaupun ada rejimen baku terapi insulin pada pasien DMT1 yaitu dengan tiga kali suntikan

    insulin prandial sebelummakandan suntikan insulin basal padamalamhari, namunberbagai

    variasi rejimen dapat diberikan sesuai dengan kenyamanan dan kebutuhan kendali glikemik

    pasiensepertiyangdianjurkanolehChengandZinman (Tabel IV.1).Yangpalingprinsipdalam

    rejimeniniadalahwajibadainsulinprandialdaninsulinbasal,tidakbolehhanyadiberikansalah

    satu jenis insulin. Dan, tidak dianjurkan memberikan terapi insulin hanya dengan dua kali

    suntikan,karenaamatsulitmencapaikendaliglikemikyangbaikdengancaratersebut.Rejimen

    terapi insulin pada pasien DMT1 juga dapat diberikan dengan menggunakan pompa insulin

    (continuoussubcutaneousinsulininfusion[CSII])yangdosisinsulinnyadapatdiaturbaikdengan

    caramanualmaupunautomatis.

    TabelIV.2.BerbagairejimensuntikaninsulinmultipelpadapasienDMT1

    Sebelummakan

    pagi

    Sebelummakan

    siang

    Sebelummakan

    malam

    Sebelumtidur

    IP

    IP+IB

    IP+IB

    IP+IB

    IP

    IP

    Tanpainsulin

    IP+IB

    IP

    IP

    IP

    IP+IB

    IB

    IB

    IB

    Tanpainsulin

    IP=insulinprandial(reguler,lispro,aspart,glulisine);IB=insulinbasal(NPH,glargine,detemir).

    ChengandZinman.JoslinsDiabetesMellitus,2005

  • 12

    C.2DiabetesMelitusTipe2

    Terapi insulin pada pasien DMT2 memang mempunyai kendala tersendiri, baik berasal dari

    dokternyamaupundaripasiennya.TersedianyaberbagaiOHOjugamenjadisalahsatukendala

    keterlambatan pemberian terapi insulin, walaupun sebenarnya sudah ada indikasi.Meskipun

    demikian,tidaksemuapasienDMT2membutuhkaninsulin.Sangattergantungderajatglikemik

    dankepatuhanpasiendalammelaksanakanprinsippengelolaandiabetes(perbaikanpolahidup

    di samping konsumsi obat). Prinsip dasar dari tujuan pengelolaan diabetes adalah sasaran

    glikemik; karenanya keberhasilan segala bentuk terapi adalah tercapainya kendali glikemik

    (A1C). Untukmencapai A1C yang baik, dibutuhkan seni pengobatan untukmencapai sasaran

    yang baik dari kadar glukosa darah baik dalam keadaan puasa atau sebelummakanmaupun

    kadarglukosadarahsetelahmakan.

    Pertanyaan tentang kapan memulai terapi insulin pada pasien DMT2 memang tidak selalu

    mudahdijawab.Walaupundemikian,darihasilberbagaiujiklinikpalingtidakadaduaasosiasi

    besar(ADAEASD,2009danAACE/ACE,2009)yangtelahmengeluarkankesepakatanyangdapat

    digunakansebagaiacuandasar.BerdasarkankesepakatanADAEASD,untukpasienDMT2baru

    wajibdiberikanterapipolahidupdanmetformin(Langkah1).Jikadalamkurunwaktu23bulan

    sasaran terapi belum tercapai (A1C 10%, atau gejala diabetes yang nyata (poliuria, polidipsia, dan berat badan

    menurun),maka terapi insulindengankombinasipolahidupmerupakan terapipilihan.Pasien

    tersebutmungkinDMT1 yangbelumdikenal atauDMT2dengandefisiensi insulin yangberat.

    Terapi insulin secara titrasi diberikan sampai sasaran kadar glukosa darah tercapai dengan

    cepat.Dansetelahgejalagejalamenghilangdansasaranglukosadarahtercapai,obatoraldapat

    ditambahkandan insulin mungkinbisadihentikan.Sedikitvariasisepertiyangdianjurkanoleh

  • 13

    AACE/ACE di mana terapi insulin untuk pasien DMT2 baru terdiagnosis juga didasarkan atas

    kendaliglikemik(A1C>9).

    GJK=gagaljantungkongestif.

    GambarIV.2.AlgoritmepengelolaanDMT2.

    NathanDMetal.DiabetesCare2009;32:193203.

    D. StrategiPraktisTerapiInsulin

    D.1.Insulinbasal

    Saat ini tersedia beberapa insulin basal di pasar Indonesia, yaitu insulin NPHmanusia (kerja

    menengahatauintermediet),insulinanalogglarginedandetemir(kerjapanjang).Dibandingkan

    denganinsulinbasalanalog, insulinbasalNPHmempunyaivariasipenyerapanyanglebihlebar

    dari hari ke hari, tidak cukup panjang kerjanya hingga kurangmemadai sebagai insulin basal

    ideal(bekerjaselama24jam),danlebihseringmenyebabkanefeksampinghipoglikemia.

    Dosisinsulinbasalpadaawalpemberiannyaadalah10unitperhari,yangdapatdiberikanpada

    saat sebelum tidur (kerja menengah atau panjang) atau pagi hari (kerja panjang). Untuk

    penyesuaian dosis harian, dosis insulin dapat dinaikkan 2 unit setiap tiga hari jika sasaran

    glukosakadardarahpuasabelumtercapai (antara70130mg/dl).Dapat jugadinaikkan4unit

    setiaptigaharijikakadarglukosadarahpuasamasihdiatas180mg/dl(TabelIV.2).

  • 14

    TabelIV.3.Carapraktispenyesuaiandosisinsulinbasal

    Kadarglukosadarahpuasa(mg/dl) Dosisinsulinbasal

    130

    >180

    Turunkandosis2unit

    Pertahankandosis

    Naikkandosis2unittiap3hari

    Naikkandosis4unittiap3hari

    D.2.Insulinbasalplusdanbasalbolus

    Seperti telah disebutkan diatas, jika sasaran glikemik belum tercapai dalamwaktu 23 bulan,

    diberikanterapi insulinyang intensif.Dalampemahamanini insulintambahandiberikanuntuk

    memperbaiki kendali glikemik, yaitudengan insulinprandial; konsep ini dikenal dengannama

    basalplusdanbasalbolus,tergantungdariberapakalidibutuhkaninsulinprandialtambahan.

    Yang dimaksud dengan basalplus adalah penambahan insulin prandial untuk menurunkan

    kadarglukosadarahsetelahmakanketikapemberianinsulinbasaldanobatoralgagalmencapai

    sasaran glikemik akibat pengaruh kadar glukosa darah setelah makan (pada keadaan ini

    umumnyakadarglukosadarahpuasatelahmencapaisasaran).Insulinprandialdapatdiberikan

    satu, dua, atau tiga kali mengikuti pola makan. Pemberian satu kali insulin prandial dapat

    diberikan untukmenurunkan glukosa darah dua jam sesudahmakan pada porsi makan yang

    menaikkanglukosadarahprandialtertinggi(kadarglukosadarah12jamsetelahmakandiatas

    160180mg/dl).Ataudalampraktikseharihari,jikakadarglukosadarahtidakbisadiukursetiap

    saat, maka insulin prandial ini bisa diberikan pada saat makan dengan jumlah makanan

    terbanyak. Jika ada dua kadar glukosa darah setelah makan yang belum mencapai sasaran,

    makainsulinprandialdapatdiberikanduakali.Jikadiperlukanpemberianterapiinsulinprandial

    sebanyaktigakalidalamsehari,maka inidisebutdengankonsepbasalbolus(insulinbasal+

    tiga prandial). Insulin prandial yang diberikan dimulai dengan dosis 4 unit sehari dan dapat

    disesuaikan(dinaikkandosisnyasebanyak2unit)setiap3harijikasasaranglukosadarahsetelah

    makanbelumtercapai(GambarIV.3).Penggunaankonsepbasalbolusiniharusdisertaidengan

    pemahamanperencanaanmakanyangtepatdanpemantauanglukosadarahyangketat.Basal

    bolusdapat jugadigunakan lebih awal pada keadaan tertentu seperti:DMT1, kontrol glukosa

    darahyangburuk,dimanadibutuhkanpenurunankadarglukosadarahsecaracepat.

  • 15

    Gambar IV.3. Langkah pendekatan terapi pasien DMT2 dengan konsep insulin basal, basal

    plusdanbasalbolus.

    ModifikasidariRaccahD.DiabetesObMet2008;10:7682.

    D.3.Insulinpremixed

    Saatinitersediabeberapasediaaninsulinpremixed(insulincampurantetapantarainsulinkerja

    pendek/cepatdankerjamenengah; insulinmanusiadananalog). Insulin ini kurangdianjurkan

    diberikanpadapasienDMT1olehkarenaadanyakesulitandalampengendalianglukosadarah

    dan kurang fleksibel dalam pengaturan dosis insulin basal dan prandial sesuai dengan

    kebutuhan. Berbeda dengan pasien DMT2, karena masih ada insulin endogen (bukan

    kekurangan insulin mutlak), maka pemberian insulin premixed masih ada tempatnya dengan

    keuntungan dalam hal kenyamanan (bisa diberikan dua kali sehari). Yang perlu diperhatikan

    adalah kapan memulai pemberiannya dan apa keuntungan dan kerugian pemberian terapi

    insulinpremixeddibandingkanbasalplusataubasalbolus.

    Terapi insulin premixed sebagai terapi intensif setelah gagal dengan insulin basalmerupakan

    salah satu pilihan dalam pengelolaan pasien DMT2. Oleh karena adanya keterbatasan dalam

    penyesuaian dosis antara insulin basal dan prandial yang terkandung tetap pada insulin

    premixed,makamenurutADAEASD(2009)penggunaannyatidakdianjurkanpadamerekayang

    barumemulaipenyesuaiandosis insulin.Namundemikian,berdasarkankesepakatanparaahli

    internasional (Unnikrishnan et al., 2009) pemberian insulin premixed dapat diberikan setelah

    gagaldenganobatoralataudenganinsulinbasal.

    Insulin premixed yang diberikan sekali sehari juga salah satu strategi yang cukup berhasil

    memperbaiki kendali glikemik, yang diberikan pada saat sebelum makan malam. Namun

    demikian,secaraumumhasilnyatidaksebaikjikadiberikanduaatautigakalisehari.Pemberian

    InsulinBasalsekalisehari

    Obatoraltetapdilanjutkan

  • 16

    insulinpremixed sekali sehari dapat dimulai dengan penyuntikan pada saatmakan terbanyak

    (untukorangBaratsaatmakanmalam).Biladibutuhkanduakali,makadisuntikkanpadamakan

    terbesaryangkedua.Carasederhanauntukmengganti terapi insulinbasalsekaliatauduakali

    sehari dengan insulin premixed dua kali sehari adalah: dosis total yang sama dengan dosis

    insulin sebelumnya, kemudian dibagi menjadi 2 dosis sama besar dimana setengahnya

    diinjeksikan pada saat sebelummakan pagi dan setengahnya diinjeksikan pada saat sebelum

    makanmalam. Cara praktis untuk mengganti insulin premixed sekali sehari menjadi dua kali

    sehari adalah: bagi dosis yang diberikan dalam satu kali seharimenjadi dua (50%:50%) untuk

    pagi danmalam hari. Dan cara praktis untukmengganti insulinpremixed dari dua kali sehari

    menjaditigakalisehariadalah:tambahkan26unitatau10%dosistotalharianinsulinpremixed

    sebelum makan siang. Penurunan dosis pagi (2 sampai 4 unit) mungkin diperlukan setelah

    penambahandosissianghari.Padapenggunaaninsulinpremixedinidianjurkanuntukmentitrasi

    setiap tiga hari, namun untuk kepentingan praktis dapat dilakukan setiap minggu. Untuk

    selanjutnya secara bertahap menghentikan sulfonilurea dan tetap meneruskan metformin;

    glitazonsebaiknyadihentikanpadapenggunaaninsulin.

    E. CaraPemberianInsulin

    Carapemberianinsulinyangumumdilakukanadalahdengansempritinsulin(1ccdenganskala

    100unitper cc)dan jarum,pen insulin, ataupompa insulin (Continuous Subcutaneous Insulin

    Infusion [CSII]). Beberapa tahun yang lalu penggunaan semprit dengan jarum adalah yang

    terbanyakdigunakan, tetapi kini banyakpasien yang lebihnyamanmenggunakanpen insulin.

    Hal ini karena lebih sederhana dan mudah dalam penggunaannya disamping jarumnya juga

    lebih kecil sehingga lebih nyaman pada saat diinjeksikan. Penggunaan CSII masih terbatas di

    Indonesia, karena sangat membutuhkan keterampilan pasien dan harganya relatif mahal.

    Meskipun demikian, cara ini merupakan cara pemberian yang paling mendekati keadaan

    fisiologis.

    Penggunaan pen insulin kini lebih mudah dan nyaman dibandingkan semprit dan jarum.

    Penggunaannya lebihmudahdannyaman,pengaturandosisnya lebihakurat,danbisadibawa

    kemanamanadenganmudahpula.

    F. SasaranTerapi

    Banyak anjuran yang diajukan oleh berbagai pusat atau asosiasi keahlian dalam hal sasaran

    kendaliglikemik.ApayangdianjurkanolehADA(2010)merupakansalahsatuanjuranyangbisa

  • 17

    digunakandalampraktiksehariharikarenauntukpemeriksaankadarglukosadarahdigunakan

    darahkapiler.SasaranA1Cdibawah7%jugamerupakansasaranyangmemadaiuntukpasiendi

    Indonesia. Meskipun demikian, pada pasien dengan keadaan tertentu maka dapat

    dipertimbangkan sasaran kendali glikemik yang kurang ketat (

  • 18

    sebelum hamil, direkomendasikan sasaran kadar glukosa darah, jika dapat dicapai tanpa

    hipoglikemia, adalah glukosa darah sebelum makan, waktu tidur, dan sepanjang malam

    (overnight glucose) antara 6090 mg/dL; glukosa darah puncak sesudah makan (peak post

    prandialglucose)antara100129mg/dL;danA1C

  • 19

    V.TERAPIINSULINUNTUKPASIENHIPERGLIKEMIAYANGDIRAWATDIRUMAHSAKIT

    Terapi insulin untuk pasien yang dirawat inap tidak saja ditujukan untuk pasien yang telah

    diketahuimenderitadiabetes,tetapijugapasiendenganhiperglikemiayangbarudiketahuisaat

    dirawat di rumah sakit. Mereka yang baru diketahui menderita diabetes atau hiperglikemia

    kalau dibiarkanmaka luarannya lebih buruk (angka kesakitan dan kematian lebih tinggi) dari

    padamerekayangtelahdiketahuimenderitadiabetes.Dansebaliknyamempunyailuaranyang

    lebihbaikdaripadamerekayangsebelumnyatelahdiketahuimenderitadiabetes jikadikelola

    glukosadarahnyadenganbaik.

    Terdapatduakelompokpasienyangdirawatdi rumahsakit yakni kelompokpasienyang sakit

    kritisdantidakdapatmengkonsumsiobatsecaraoralsertakelompokpasienyangmasihdapat

    mengkonsumsi obat secara oral. Pada prinsipnya, insulin dapat digunakan pada pasien yang

    tidakdapatmengkonsumsiOHOdengansyaratterdapatalatpemantauanglukosadarah.

    A.TerapiInsulinPasienRawatInap

    Sebenarnya tidak semua pasien yang dirawat di rumah sakitmemerlukan terapi insulin. Bagi

    merekadenganpenyakit ringan,dimana kendali glukosadarahnya tercapai denganobatoral

    yang biasa digunakan sebelum dirawat di rumah sakit, terapi obat oralnya dapat diteruskan

    tanpa harus menggantinya dengan insulin. Namun demikian, sebagian besar pasien yang

    dirawatdirumahsakitmempunyaistresakutyangmemicupeningkatanglukosadarahseperti

    adanya penyakit tambahan, komplikasi dari diabetesnya atau yang akan menjalani

    pembedahan, sehinggamemerlukan terapi insulinuntukdapatmenurunkanglukosadarahnya

    dengan cepat.Memang, dalamkeadaan yangmemerlukan regulasi glukosadarah yang relatif

    cepat dan tepat, insulin adalah yang terbaik karena kerjanya cepat dan dosisnya dapat

    disesuaikandenganhasilkadarglukosadarah.

    Seperti halnya terapi insulin pada pasien diabetes yang menjalani rawat jalan, prinsip terapi

    insulin untuk pasien yang dirawat inap adalah sama.Mungkin memerlukan terapi kombinasi

    oral dan insulin atau insulin saja. Terapi insulin diberikan dengan cara subkutan secara

    terprogramatauterjadwal(tigakaliinsulinprandial,12kaliinsulinbasal,dankalaudiperlukan

    ditambah insulin koreksi atau suplemen). Pada keadaan tertentu misalnya karena suatu

    penyakit,stresataupemberianglukokortikoid,selamaperawatanterjadifluktuasikadarglukosa

  • 20

    darah dan ini memerlukan injeksi insulin prandial tambahan. Insulin prandial tambahan ini

    dikenaldengannamainsulinkoreksiatauinsulinsuplemen.

    Secaraumum,kebutuhaninsulindapatdiperkirakansebagaiberikut:insulinbasalsebanyak50%

    dari kebutuhan insulin harian total yaitu sekitar 0,2 unit/kg berat badan; insulin prandial

    sebanyak50%darikebutuhaninsulinhariantotal.

    Untuksebagianbesarpasienbukanpenyakitkritisyangditerapidenganinsulin,sasaranglukosa

    darah sebelum makan umumnya

  • 21

    (Tabel V.1). Kadar glukosa darah yang sedikit lebih rendahmungkin bermanfaat pada pasien

    tertentu (misalnyapadapasien kritis bedah), namun sasaran glukosadarah180mg/dL

    140180mg/dL

    B.2.Carapemberiandanprotokolterapiinsulin

    Terapi insulin secara infus intravena sebaiknya tidak diberikan pada mereka yang dirawat di

    ruangan tanpa fasilitas glukometer.Dalam konteks perawatan intensif, infus insulin intravena

    berkesinambunganmerupakancarayangpalingefektifuntukmencapaisasaranglukosadarah.

    Idealnya insulin intravena diberikan melalui protokol tertulis atau terkomputerisasi yang

    tervalidasi agar memungkinkan penyesuaian laju insulin infus berdasarkan fluktuasi glukosa

    darah dan dosis insulin. Keberhasilan perawatan pasien seperti ini sangat tergantung dari

    kepiawaian staf dan tinjauan periodik data pasien. Berbagai macam protokol tersedia di

    masingmasing pusat atau yang dianjurkan oleh peneliti, salah satu dapat diikuti atau

    dimodifikasi sesuai dengan protokol lokal atau sesuai dengan sarana yang tersedia. Protokol

    manapunyangdiacu, yangpentinghindari pasien jatuh kehipoglikemia.Walaupundemikian,

    luaranyangburukdarimerekayangdirawatdiruangterapiintensifinibukanhanyadisebabkan

    olehkarenahipoglikemia.

    Faktorfaktorlainnyayangmenyumbangluaranpasienadalah:

    sistempemantauan,

    fluktuasikadarglukosadarah,

    hipokalemia,

    asupanhipokalorikselamaperawatan(tunjangannutrisiyangkurangadekuat),

    hipotensiatauhipovolumia,

    danberbagaimacamkeadaanmorbid yangmendasari (gangguan saluran cerna, gagal

    hatiatauginjal,defisiensihormonkontraregulasiglukosaakibatinsufisiensipituitaridan

    adrenal).

  • 22

    Pasienyangmendapatkanterapiinsulininfusintravenabiasanyaakanmembutuhkantransisike

    insulin subkutan jikamerekamemulaimemakanmakanan biasa ataumereka akan pindah ke

    ruang biasa. Biasanya, dosis insulin subkutan diberikan antara 7580% dari dosis insulin infus

    intravena harian total, yang kemudian dibagi proporsional menjadi komponen basal dan

    prandial. Perlu dicatat, bahwa insulin subkutan harus diberikan 14 jam sebelum infus insulin

    intravenadihentikanuntukmencegahhiperglikemia(TabelV.2).

    Tabel V.2. Contoh perhitungan perubahan dosis insulin dari pemberian infus intravena ke

    subkutan

    Misalnya pasien yang diterapi dengan insulin infus intravena adalah 2 unit/jam dalam 6

    jamterakhir,berartidosisinsulinhariantotaladalah48unit

    Kebutuhan insulin subkutan adalah 80% dari insulin harian total yang diberikan secara

    infusintravena:80%x48unit=38unit

    Dosisinsulinbasalsubkutan:50%dari38unit=19unit

    Dosisinsulinprandial:50%dari38unit=19unit;dibagitigamasingmasing6unitsetiap

    kalisebelummakan(makanpagi,siangdanmalam)

    ADA,DiabetesCare2010;33:S11S61

  • 23

    VI.TERAPIINSULINPADAPASIENPERIOPERATIF

    Dosistetap

    CekGD12jambedside

    CekGDtiap15menit

    GD8199GD6080GD400:+34UGD300400:+12UGD200299:+0,5

    1U

    Dosis50% Dosis50%

    Targettercapai Targettidak

    tercapai

    GD100149 GD>200 GD>100GD200)

    Persiapan:Syringepump,spuit50mL

    Buatlarutanregularinsulin1unit/1mLNaCL0,9%1

    DripstopBolusD40%1flInfusD5%/8j

    DripstopBolusD40%flInfusD5%/8jam

    Dripstop+infusD5%/8jam

    GD>1001jamkemudiantetap>100drip

    insulindimulaikembali50%daridosisterakhir.InfusD5%stop

  • 24

    Catatan:

    Dosisbolusinisial:GDawaldibagi100dandibulatkanke0,5Uterdekat

    Contoh:GD236dosisbolus236:100=2,362,5U

    GD281dosisbolus281:100=2,813U

    Bilainsulinstop,evaluasiGDtiapjam

    - BilaGDbelummencapai100protokolhipoglikemiaditeruskan.

    - BilacekulangGD>1001jamberikutnyadripinsulindimulaikembalidengandosis

    50%daridosisterakhir.

    PenilaiandanpenyesuaianolehdoktermasihdiperlukanuntukkasuskasusekstrimatauGDyangfluktuatifdansulitdiprediksi.

  • 25

    VII.TERAPIINSULINPADAKETOASIDOSISDIABETIKDANSTATUSHIPERGLIKEMIA

    HIPEROSMOLAR

    A. DefinisidanDiagnosis

    Ketoasidosis diabetik (KAD) dan status hiperglikemia hiperosmolar (SHH) merupakan

    komplikasimetabolikakutpalingseriuspadapasiendiabetesmelitus.Manifestasiutamanya

    adalahkekuranganinsulindanhiperglikemiayangberat.SHHterjadiketikadefisiensiinsulin

    yang relatif (terhadap kebutuhan insulin) menimbulkan dehidrasi dan akhirnya

    menyebabkankondisihiperosmolaritas.KADterjadibilakekuranganinsulinyangberattidak

    saja menimbulkan hiperglikemia dan dehidrasi yang berat, tapi juga mengakibatkan

    produksi keton meningkat serta asidosis. Diagnosis KAD ditegakkan bila ditemukan

    hiperglikemia(>250mg/dL),ketosisdarahatauurin,danasidemia(pH

  • 26

    2. Insulinintramuskular

    Penurunan kadar glukosa darah yang dicapai dengan pemberian insulin secara

    intramuskular lebih lambat dibandingkan dengan cara pemberian infus intravena

    berkelanjutan.Terapi insulin intramuskulardosisrendah(5unit)yangdiberikansecara

    berkala(setiap12jam)sesudahpemberianinsulindosisawal(loadingdose)sebesar20

    mU juga merupakan cara terapi insulin pada pasien KAD. Cara tersebut terutama

    dijalankan di pusat pelayanan medis yang sulit memantau pemberian insulin infus

    intravena berkelanjutan. Pemberian insulin intramuskular tersebut dikaitkan dengan

    kadarinsulinserumsekitar6090U/dL.

    3. Insulinsubkutan

    TerapiinsulinsubkutanjugadapatdigunakanpadapasienKAD.Namun,untukmencapai

    kadar insulin puncak dibutuhkan waktu yang lebih tahan lama. Cara itu dikaitkan

    dengan penurunan kadar glukosa darah awal yang lebih lambat serta timbulnya efek

    hipoglikemia lambat(latehypoglycemia)yang lebihseringdibandingkandenganterapi

    menggunakaninsulinintramuskular.

    Padamayoritaspasien,terapiinsulindiberikansecarasimultandengancairanintravena.

    Apabila pasien dalam keadaan syok atau kadar kalium awal kurang dari 3,3 mEq/L,

    resusitasidengancairan intravenaatausuplemenkaliumharusdiberikan lebihdahulu

    sebelum infus insulin dimulai. Infus insulin intravena 57 U/jam seharusnya mampu

    menurunkan kadar glukosa darah sebesar 5075mg/dL/jam serta dapatmenghambat

    lipolisis, menghentikan ketogenesis, dan menekan proses glukoneogenesis di hati.

    Kecepatan infus insulin harus selalu disesuaikan. Bila faktorfaktor lain penyebab

    penurunankadarglukosadarahkurangdari50mg/dL/jam,makakecepataninfusinsulin

    perlu ditingkatkan. Penyebab lain dari tidak tercapainya penurunan kadar glukosa

    darah,antaralainrehidrasiyangkurangadekuatdanasidosisyangmemburuk.

    Bila kadar glukosa darah sudah turun

  • 27

    TabelVII.1.PanduancarapemberianinsulinpadapasienKADdanSHHdewasa

    Pemberianawalintravena10Uatau0,15U/kgBB

    Infusinsulinregular(insulinkerjapendek)0,1U/kgBB/jamatau5U/jam

    Tingkatkandosisinsulin1Usetiap12jambilapenurunanglukosadarah

  • 28

    VIII.KEAMANANDANEFEKSAMPINGINSULIN

    A. PenggunaanPadaWanitaHamil

    Pemberian obatobatan pada wanita hamil selalu menjadi perhatian para dokter karena

    harus mempertimbangkan keamanan terhadap bayi yang dikandungnya disamping

    keamanan terhadap ibunya. Penggunaan insulinmanusia pada wanita hamil sudah teruji

    keamanannya. Yang perlu diperhatikan adalah keamanan dari insulin analog yang

    penggunaannyarelatifbaru.Salahsatuinsulinanalogkerjacepat,aspart,telahdilakukanuji

    keamanan pada wanita hamil baik yang menderita DMT1 maupun DM gestasi. Ternyata

    obatinidisampingdapatmengendalikanglukosadarahdenganbaikjugaamanuntukbayi.

    Insulin glargine, jika digunakan dalam kadar terapeutik pada wanita hamil juga aman,

    karenatidakmelewatiplasenta.

    Walaupuntelahadaujicobapenggunaaninsulinanaloguntukwanitahamil,namunkarena

    jumlahpenelitianbelumbanyakdansampaisaat inibelumadasatupunorganisasiprofesi

    atau badan (seperti Balai POM atau FDA) yang telahmenyatakan aman,maka sebaiknya

    dihindaripenggunaannyasampaikeamananditetapkan.

    B. Hipoglikemia

    Efeksampinginsulinyangpalingpentingdiperhatikanadalahhipoglikemia.Sasaranglukosa

    darahyangterlaluketatterutamauntukpasienyangdirawatdiruangterapiintensifsering

    menimbulkanefeksampinghipoglikemia.Dan inidapatmemperburuk luaranklinikpasien

    kritis.Karenanya,kiniadakecenderunganmemperendahsasaranglukosadarahyang ingin

    dicapai untuk pasien kritis. Penggunaan insulin analog sedikit mengurangi efek samping

    hipoglikemia dibandingkan insulin manusia. Edukasi kepada pasien rawat jalan yang

    menggunakanterapiinsulinuntukmengendalikanglukosadarahnyaperludiberikandengan

    baik dengan harapan mengurangi kejadian hipoglikemia. Edukasi ini meliputi konsep

    tentang glukosa darah basal dan prandial, fungsi insulin basal dan insulin prandial, serta

    pemantauanglukosadarahyangmandiri.

    C. PeningkatanBeratBadan

    Peningkatanberatbadanpadapasienyangmenggunakanterapiinsulindapatdisebaboleh

    beberapa keadaan. Insulin sendiri merupakan hormon anabolik, penggunaannya pada

    pasien dengan kendali glikemik yang buruk akan meningkatkan berat badan karena

  • 29

    pemulihanmasa otot dan lemak. Adanya asupan tambahan akibat kejadian hipoglikemia,

    atau asupan makan yang lebih banyak karena merasa menggunakan insulin juga dapat

    menyebabkanpeningkatanberatbadan.Penggunaan insulindetemir sebagai insulinbasal

    memberikan peningkatan berat badan yang lebih rendah dibandingkan obat insulin yang

    lainnya.

    D. EdemaInsulin

    Edema dapat terjadi pada pasien yang memiliki kendali glikemik yang buruk (termasuk

    pasien dengan ketoasidosis) akibat retensi garam dan air yang akut. Edema akan

    menghilangsecaraspontandalambeberapahari.Kalaudiperlukanuntuksementaradapat

    diberikan terapi diuretik. Edema pada pemberian insulin juga dapat terjadi pada

    penggunaannya bersamaan dengan obat oral golongan glitazon. Kalau efek samping

    tersebut menyebabkan perburukan klinik, maka sebaiknya obat golongan glitazon

    dihentikan.

    E. LipoatrofiatauLipohipertrofi

    Suntikan insulin yang kurang murni ke dalam lemak subkutan kadangkadang dapat

    menyebabkan kehilangan lemak terlokalisasi. Dengan insulin yang murni yang ada

    belakangan ini,masalah ini jarang terjadi. Jika insulin disuntikkan di sekitar tempat yang

    terjadilipoatrofi,makalemaksubkutanakankembalidalambeberapabulansampaitahun.

    Kebalikandenganliupoatrofi, lipohipertrofimungkinterjadipadatempatsuntikan.Tempat

    suntikan akan membengkak akibat penumpukan lemak subkutan karena suntikan yang

    berulang. Sensitivitas nyeri mungkin berkurang pada tempat tersebut, juga akan terjadi

    peningkatanmasa jaringan ikat fibrosa. Penyerapan insulin yangdisuntikkanpada tempat

    lipohipertrofi mungkin tidak teratur dan tidak bisa diramalkan. Penyuntikan dengan cara

    rotasi akan menghindari kejadian lipohipertrofi. Dan jaringan yang bertambah akan

    berkurangsecaraperlahanbersamaandenganwaktu.

  • 30

    IXTEHNIKPENYUNTIKANDANPENYIMPANANINSULIN

    A.TehnikPenyuntikanInsulin

    Tips supaya penyuntikan tidak menyakitkan : gunakan insulin pada suhu kamar; jika

    menggunakan alkohol, suntik hanya ketika alkohol telah sepenuhnya kering; hindari

    penyuntikanpadaakar rambut, gunakan jarumyang lebihpendekdandiameter lebih

    kecil,gunakanjarumbaru.

    Masukkanjarumdengangerakancepatsepertipanahmelaluikulit.Suntikkanperlahan

    dan pastikan bahwa plunger (jarum suntik) atau tombol (pen) telah sepenuhnya

    tertekan.

    Pada penggunaan pen, setelah menekan tombol secara penuh, pasien harus

    menghitungperlahansampai10sebelummenarikjarum.

    Jarum 5mm dan 6mm dapat digunakan oleh setiap pasien dewasa termasuk yang

    obesitas dan umumnya tidak memerlukan pengangkatan lipatan kulit. Selain itu

    sebaiknyadiberikandengansudut900terhadappermukaankulit.

    Namun, penggunaan lipatan kulit atau penyuntikan pada sudut 450 harus

    dipertimbangkanuntukinjeksianggotabadanataukeperutyanglangsing.

    Tidak ada alasan medis untuk merekomendasikan jarum >8mm. Terapi awal harus

    dimulaidenganjarumyanglebihpendek.Pasienyangsudahmenggunakanjarum>8mm

    harus mengangkat lipatan kulit atau menyuntikkan pada 450 untuk menghindari

    suntikanIM.

    Urutanyangoptimal:membuatlipatankulit;suntikkaninsulinperlahanpadasudut900

    terhadap permukaan lipatan kulit; setelah plunger sepenuhnya tertekan (pada pen)

    biarkan jarum di kulit selama 10 detik; menarik jarum dari kulit; melepaskan lipatan

    kulit;membuangjarumsecaraaman.

    Pasien harus diajarkan untuk memeriksa lokasi injeksi dan mampu mendeteksi

    lipohipertrofi.

    Tidak boleh menyuntik ke dalam bidang lipohipertrofi sampai jaringan abnormal

    kembalinormal(dapatmemakanwaktubulanansampaitahunan)

    Memindahkan lokasi suntikan dari lipohipertrofi ke jaringan normal sering

    membutuhkanpenurunandosisinsulinyangdisuntikkan.

    Strategi pencegahan dan terapi yang terbaik untuk lipohipertrofi adalah dengan

    penggunaaninsulinmanusiadimurnikan,rotasilokalinjeksi,menggunakanzonainjeksi

    lebihbesar,tidakmenggunakankembalijarumyangtelahdigunakan.

  • 31

    Pasienharusdiajarkanskemarotasiyaitu:membagitempatinjeksikedalamkuadran(

    atau bagian bila menggunakan paha atau bokong), menggunakan satu kuadran per

    mingguataubagianharusberjarakminimal1cmdarisatusamalainuntukmenghindari

    traumaulangjaringan.

    Wanitahamildengandiabetes:yangmenyuntikkankedalamperutharusmemberikan

    suntikan dengan mengangkat lipatan kulit; hindari menggunakan lokasi perut sekitar

    umbilikus selama trimester terakhir; injeksi ke sisisisi perut masih dapat digunakan

    denganmengangkatlipatankulit.

    B.TehnikPenyimpananInsulin

    Simpaninsulinyangdigunakan(pen,cartridgeataubotol)padasuhukamar(maksimal1

    bulansetelahpemakaianpertama,danbelumkadaluwarsa).Simpaninsulinyangbelum

    dibukadidalamkulkastetapijangandisimpandidalamfreezer.

    Cloudy insulin (misalnyaNPHdan premixed insulin) harus secara lembut diputar dan

    atau dimiringkan (jangan diguncang) selama 20 siklus sampai kristal kembali larut ke

    dalamsuspensi(larutanmenjadiberwarnaputihsusu)

  • 32

    DAFTARPUSTAKA

    AmericanDiabetesAssociation.StandardsofMedicalCareinDiabetes2010.DiabetesCare

    2010;33:S11S61.

    Balasubramanyam A. Intensive Glycemic Control in the Intensive Care Unit: Promises and

    Pitfalls.JClinEndocrinolMetab.February2009;94:416417.

    DandonaP,AljadaA,ChaudhuriA,MohantyP,GargR.MetabolicSyndrome.AComprehensive

    Perspective Based on Interactions Between Obesity,Diabetes, and Inflammation.Circulation

    2005;111:14481454.

    Gisela Del Carmen De La Rosa GDC, Donado JH, Restrepo AH,Quintero AM, Gonzlez LG,

    SaldarriagaNE,BedoyaM,ToroJM,VelsquezJB,ValenciaJC,ArangoCM,AlemanPH,Vasquez

    PM, Chavarriaga JC, Yepes A,PulidoW, Cadavid CA and Grupo de Investigacion en Cuidado

    intensivo: GICIHPTU. Strict glycaemic control in patients hospitalised in a mixedmedical and

    surgical intensive care unit: a randomised clinical trial. Critical Care 2008, 12:R120

    (doi:10.1186/cc7017).

    Griesdale DEG, de Souza RJ, van Dam RM,Heyland DK, Cook DJ, Malhotra A, Dhaliwal R,

    HendersonWR,ChittockDR,FinferS,TalmorD.Intensiveinsulintherapyandmortalityamong

    criticallyillpatients:ametaanalysisincludingNICESUGARstudydata.CMAJ2009;180:821827.

    HodM,Damm P, Kaaja R, Visser GAH, Dunne F,Demidova I,Hansen AP,Mersebach H,for the

    Insulin Aspart PregnancyStudy Group. Fetal and perinatal outcomes in type 1 diabetes

    pregnancy:a

    randomized study comparing insulin aspart with humaninsulin in 322 subjects. Am J Obstet

    Gynecol2007;XXX:xxxx.

    MathiesenER,KinsleyB,AmielSA,HellerS,McCanceD,DuranS,BellaireS,RabenA,OnBehalf

    of The InsulinAspartPregnancyStudyGroup.MaternalGlycemicControl andHypoglycemia in

    Type 1 DiabeticPregnancy. A randomized trial of insulin aspart versus human insulin in 322

    pregnantwomen.DiabetesCare2007;30:771776.

  • 33

    MoghissiES,KorytkowskiMT,DinardoM,EinhornD,HellmanR,Hirsch IB, InzucchiSE, Ismail

    Beigi F, Kirkman MS, Umpierrez GE. American Association of Clinical Endocrinologists and

    AmericanDiabetes Association Consensus Statement on InpatientGlycemic Control. Diabetes

    care2009;32:11191131.

    Nathan DM,Buse JB, Davidson MB, Ferrannini E, Holman RR, Sherwin R, Zinman B. Medical

    ManagementofHyperglycemiainType2Diabetes:AConsensusAlgorithmfortheInitiationand

    AdjustmentofTherapy.Aconsensusstatementof theAmericanDiabetesAssociationand the

    EuropeanAssociationfortheStudyofDiabetesDiabetesCare2009;32:193203.

    PollexEK,FeigDS,LubetskyA,YipPM,KorenG.PollexEKInsulinGlargineSafetyinPregnancy.A

    transplacentaltransferstudy.DiabetesCare2010;33:2933.

    RaccahD.OptionsfortheIntensificationofInsulinTherapiWhenBasalInsulinisNotEnoughin

    Type2DiabetesMellitus.DiabetesObMet2008;10:7682.

    RodbardHW,JellingerPS,DavidsonJA,EinhornD,GarberAJ,GrunbergerG,HandelsmanY,Horton

    ES,LebovitzH,LevyP,MoghissiES,SchwartzSS.AACE/ACEConsensusStatement.Statementby

    anAmerican Association of Clinical Endocrino logists /American College of

    EndocrinologyConsensusPanelonType2DiabetesMellitus:AnAlgorithmforGlycemicControl

    AACE/ACEDiabetesMellitusClinicalPracticeGuidelinesTaskForce.AACEguidelines.American

    Association of Clinical Endocrinologist Medical Guidelines for Clinical Practice for The

    managementofDiabetesMellitus.EndocrPract2009;15:540559.

    TheNICESUGARStudy Investigators.IntensiveversusConventionalGlucoseControlinCritically

    IllPatients.NEnglJMed2009;360:128397.

    UnnikrishnanAG,Tibaldi J,HadleyBrownM,KrentzAJ, LigthelmR,DamciT,Gumprecht J,Gero

    L,MuY,RazI.PracticalguidanceonintensificationofinsulintherapywithBIAsp30:aconsensus

    statement.JClinPract,November2009;63:15711577.

    Wiener RS; Wiener DC; Larson RJ. Benefits and Risks of Tight Glucose Controlin Critically Ill

    Adults.AMetaanalysis.JAMA.2008;300:933944.

  • TIM REVISI

    PETUNJUK PRAKTIS

    TERAPI INSULIN PADA PASIEN DIABETES MELITUS

    Ketua

    Prof. Dr. dr. Ketut Suastika, SpPD-KEMD

    Anggota

    dr. Mardianto, SpPD

    dr. Eva Decroli, SpPD-KEMD

    dr. Alwi Shahab, SpPD-KEMD

    dr. Em Yunir, SpPD-KEMD

    dr. IGN Adhiarta, SpPD-KEMD

    dr. Heri Nugroho, SpPD-KEMD

    dr. Luthfan Budi Pramono, SpPD-KEMD

    Prof. Dr. dr. Djoko Hardiman, SpPD-KEMD

    Prof. Dr. dr. Agung Pranoto, MSc., SpPD-KEMD

    dr. Fabiola Adam, SpPD

    dr. Yuanita Langi, SpPD

    dr. Putu Moda Arsana, SpPD-KEMD

    Cover Insulin 2011Kata Pengantar Insulin 2011Daftar Isi Insulin 2011Terapi Insulin Final 2011Tim Penyusun Insulin