PERKEMBANGAN ADVANCED CERAMIC DI .mengidentifikasilkarakterisasi produk advanced ceramic daD atau

download PERKEMBANGAN ADVANCED CERAMIC DI .mengidentifikasilkarakterisasi produk advanced ceramic daD atau

of 9

  • date post

    02-Mar-2019
  • Category

    Documents

  • view

    232
  • download

    0

Embed Size (px)

Transcript of PERKEMBANGAN ADVANCED CERAMIC DI .mengidentifikasilkarakterisasi produk advanced ceramic daD atau

Proslding Pertemuan IlmJah limu Pengetahuan dan Teknologl Bahan '99Serpong, 19-20 Ok/ob 1999 ISBN 1411- 2213

PERKEMBANGAN ADVANCED CERAMIC DI INDONESIA

Suripto, R.I.F. Wenas daft Fanani HamzahPeneliti pada Balai Besar Industri Keramik Bandung

ABSTRAK

PERKEMBANGAN ADVANCED CERAMIC DI INDONESIA. Advanced ceramic banyak terdapat sebagaikomponen barang elektronika, telekomunikasi, peralatan sensor, bio teknik, tekniklstruktural daDsebagainya. Perkembanganindutri keramik advanced ceramics belum mengembirakan, karena ada beberapa industri saja yang memproduksi komponenadvanced ceramic, seperti ceramic Honey Comb untuk kata/is converter pada automotif, spark plug, komposit gelaslpolimerdaD komponen elekaronilca(resistorlkapasitor). Usaha pengembangan advanced ceramic, baru pada tingkat litbang untukmengidentifikasilkarakterisasi produk advanced ceramic daDatau pembuatan komponen advanced ceramic menggunakanbahan baku asa impor. Dulcunganindustri pengolahan bahan baku siap pakai sangat diperlukan utamanya yang memanfaatkansomber daya alam dalam negeri seperti bauksit, pasir zirkon, magnetit, ilmenit, magnesit/dolomit, grafit, slika daDbatuan fosfat.Promosi investasi untuk pengolahan SDA perlu dipacu daDdigalakan untuk mendorong pengembangan advanced ceramicindustries daDpengembangan riset terapan dalam bidang advanced ceramics.

ABSTRACf

DEVELOPEP OF APV ANCED CERAMICS IN INDONESIA. Advanced ceramics have a wide application, mostof them are used as a ceramic component of electronics, telecomunication, sensor, bio technology, structural! engineeringmaterial etc. Advanced ceramic industries in Indonesia are still not developed yet until now, except for a few component suchas subtract for automotive catalytic conventer or ceramic honey comb, spark plug, glass reinforced polymer composites andceramic electronic components, Efforts to developedevelop and advanced ceramics products due to un availabily of the rawmaterials which produced in country are still limited in the field ofresearchs done by R & D institutes using imported materials.The goverment should invite the investor persuasively 'to invest ther money to beneficiate the local raw material resources suchas bouxite, zircon sand, magnetite, ilmenit, magnesite/dolomite, graphite, silica sand or quartz and phosphate rock that arepotentially found in the country, It is very important in order to accelerate and emphasis the growth of aDvanced ceramiccomponent industries and develop the applied research on an advanced ceramics field.

Kata kuncl: Advance ceramic, Katalis converter, spark plug, Komposit gelas

PENDAHULUAN

VINCENZINI [1] menyatakanbahwa defmisikeramikyangmasihdapatditerimahinggasaat iniadalahdefinisikeramikmenwutKINGERYyaitu:keramikadalahproduk seni clan gains dalam pembuatan clanpenggunaan bahan padatan yang berisi komponenesensial clan tersusun dalam bagian besamya berupabahan anorganik bukan logam yang terjadi karenaadanya panas yang bekerja padanya.

Selanjutnya Kingery [2] mengelompokkanproduk keramik menjadi duB kelompok besar yaitukelompok keramik tradisional clan New Ceramics(KeramikBaru).

Yang dikelompokkandalamkeramikbarn ini [2]adalahPureOxideCeramics,NuclearFuels(UO2),ElectroOptic Ceramics (Lithium Niobatl LiNbO), PL ZT(LanthanumModified Lead ZirconTitanate),Magnetic

Ceramics,SingleCrystals(GarnetLaserCrystals),CeramicNitride (Si)N., Sialon, BN dan sebagainya), Enamels forAluminium,MetalCeramicComposites,CeramicCarbides,Ceramic Borides, Ferro Electric Ceramics (BaTiO) daDsebagainya),Non SilicateGlasses, Glass Ceramics (gelasyang tinggi krista1nya) dan Porefree Poly CrystallineOxide~ (produk berbasis Alumina, Yttria, Spinel,Magnesia, Ferrites dan lainnya).

VINZENCINI [I] mendifinisikan AdvancedCeramics adalah produk keramik barn, yang teknikproduksinyapun berbeda dibandingkan dengan keramiktradisionallkonvensional.Pada pembuatan bahanlprodukkeramik maju (advanced ceramics) dikenal teknik-teknikproduksi seperti Plasma & Flame Spraying, ChemicalVapourDeposition (CVD), Physical Vapour Deposition(PCD). Hot Isostatic Pressing (HIP), CombustionSynthesis clanMetal Organic Route.

~'2

Tabel I. Contoh tipe komposit den penggunaannya[5]

Perkembangan Advance Ceramic di Indonesia (Suripto)

Gelas keramik mernpakan suatu material barndimana jenis danpemakaiannyaternsberkembang.Gelaskeramikdapatmemilikikekuatanmekanikyanglebihtinggidari gelas dasamya. Pernbahan rasadari amorfke kristaldihasilkan dengan pengontrolan devitrifikasi dati gelasdengan cara pengaturan perlakuan panas.[3].Penggunaan gelas keramik sangat lOBSseperti alaimemasak, bahan bangunan, komponen elektonik, armorclanradome.

Usaha peningkatan performance (karakteristik)keramik yang didukung oleh multi disiplin Hmupengetahuan telah menghasilkan komposit dimanaterlihat memiliki "toughness" sekitar 5 (lima) kali lebihbesar dati toughness monolitikkeramik [4].Peningkatantoughness didalam komposit matrik keramik diperolehmelalui pemutusan penjalaran/retakan sekitar serat,meningkatnya gays (stress) yang diperlukan untukmematahkan serat stag meningkatnya energi yangdiperlukan untuk menarik serat dati matrik sekelilingnya[3,4]sebagaicontohAI2O3monolitikmemilikitoughnessantara 3-5 Mpa .vm.Penambahan SiC whisker sebanyak20%volume menghasilkanmaterial (AlP/SiC) dengantoughness7,8Mpa.vm clankuat lentur700 Mpa [4].Sifatmekanik komposit serat gelas/polimer merupakankombinasi dari stifness clan hardness yang tinggi datikeramik dengan sifat toughness daripolimer [5]. TobellMenunjukkan beberapa contoh tipe komposit dabpenggunaannya.

Tabell. Contoh tipe komposit den penggunaannya [5]

Perkembangan Industri Keramik Maju di Indonesia.

Beberapa IKM di Indonesia sudah ada yangbergerak dalam bidang komposit serat gelas/polimer.Produkyang dihasilkandiantaranyabarangcinders mata,komponenbahanbangunan,tangkiair,balemandl,asesorikendaraan, helm clanpenyambung reIkereta Bpi.Produkyang dihasilkan terutamaproduk untukkeperluansehari-barf yang tidak memerlukan persyaratan kualitas yangketat. Untuk produk yang memerlukan persyaratanketatseperti penyambung reI kereta Bpi masih perlupeningkatan motu produksinya. Bahan baku yangdipergunakan sebagian besar masih produk impor yaitu

untuk hampir semua polimer clan sebagian serat gelas.Agar industrijenis ini berkembang lebih baik diperlukandukungan berupa tumbuhnya industri bahan baku clandukungan litbang.

Industri Potensial Masa Yang Akan Datang

Jenis produk keramik maju yang memiliki patensiyang cukup balk untuk diproduksi masa yang akan datangdi Indonesia adalah produk berbasis alumina, produkgelas keramik dan komposit gelas/polimer. Faktor utamayang mendukung adalah ketersediaan bahan baku berupabauksit clan pasir kuarsa. Pendukung lainnya untukproduk gelas keramik clankomposit gelaslpolimeradalahaspek pemasaran karena produknya biBBuntuk keperluansehari-hari. Disamping itu produk jenis ini dapatdilakukan oleh iridustri keciVmenengah (IKM).

Pengelompokkan keramik maju (advancedceramics) didasarkan kepada sifat utama rasa clanpemakaian. Produk-produk yang termasuk dalam keduakelompok tersebut dapat dilihat pads Tabel2 dab 3.

Tabel 2. Klaslfikasl keramlk miUuberdasarkanslratutama fasa.

2"

..Non . Graphite,Ny

OystaIlinc Dianmd

(!'CD). ShN.,AlN.B..N..

SiAl.(JIl. AlON. SiC.OC. BC,BN. ShN.,SiC. PSZ(PaIiailyStabiliml

Zin:oo). zr A.zr MlW1E. zr SPINEL. CFC(CubooFibreCuboo)SiC \\hisker reinflll'COiAlunim. GLAZE,CVDCoating. PVDCaIti~. Coati~ byPlIL'miSprayi~

3.I~t

eooq

Pascucci & KATZ [6] mendifinisikan advancedceramics sebagai bahan-bahan yang memungkinkandiperolehnya kinerja yang signifikan clanmemberikankeuntungan kepada sistem yang menggunakannya.Misalnya : Electronic. Telecomunication. SensorTechnology. Bio Technology clan StructuralApplication. Keramikmaju merupakan keramik modemberkinerjatinggi,yangmengkombinasikanpengendaliankimia secara hati-hati clan sengaja dirancang

"

No TIPE PENGGUNAANKOMPOSIT

I. SIC I AhO! Radom. armor, cuttIng tool

2. ZrO2 I A120] Komponen mesin otomotif

3. TiC I AI2O! Cutting tool

4. Gelas I Epoksi Motor boat, Blat DIsh raga, armor,bahan bangunan, komponenkendaraan.

S. SiC I AI Komponen mesin otomolif

6. SIC I Si!N. Komponen mesin

Prosiding Pertemuan Ilm/ah limu Pengetahuan don Teknologi Bahan'99Serpong, 19- 20 Oktober 1999 ISSN 1411-2213

Tabel 3. Klasifikasi keramik maju bHdasar fungsifpenggunaannya

34

FUNGSI JENIS KERAMIK PENGGUNAAN

1. DEKORA TIFf 1. Gelas Keramik 1. Reproduksl gambar untuk keperluanORNAMENTAL 2. Film Tipis ornamental

3. Batu Mulia Buatan 2. Film tipis keemasan pada jam tangan daD4. SbN., AhO! lainnya

3. Batu mulia4. Rumah arloji

2. RUMAH 2. I. Gelas Keramik Vas, ART, Alat Masak, Plat PemanasTANGGA

3. ELEKTRONIK 1. Bahan Isolasi Substrat untuk rangkaian IC, gasket, kawat,2. (AhO!, BeO, MgO, resistor electronic, switch untuk voltase tinggi3. Spinel ZrSiO., SiC4. (Beo) AlN).2. Bahan Ferroelektrik Kapasitor keramlk

(BaTiO!, SrTiO!, PbTiO!)3. Bahan Piezoelektrik Vibrator, oscilator, filter tranducer, ultrasonic

(PZT, BaTiO!, Pb (Ti, Zr, Sn, Ht)O! humidi fier, piezoelektrik spark genera tor.4. Semikonduktor . Termistor NTC

BaTiO!, MoSh, SiC . Termistor PTC (elemen pemanas saklar dll)ZnO-BhO!.V,Os . VaristorLogam transisi lainnya . Bahan Cd untuk solar collector. SiC heating element. ZrO, heating element. MoSh heating element

5. Bahan-bahan induksi ion Fuel cell, Sadium Battery Sensor Oxygen, pHJ3AhO!, ZrO" Nasicon meter.

6. Super Konduktor Komponen mikroelektronikLa,-xBax CuO.. Micro Super ComputerSr,-xB80.8CoO. Microwaves DeviceYo.,B80.8CoO. Micro Transformer listrik

4. MAGNETI