Obat Tumor Rahim Selain Operasi | OBAT KANKER RAHIM

download Obat Tumor Rahim Selain Operasi | OBAT KANKER RAHIM

of 6

  • date post

    03-Dec-2015
  • Category

    Documents

  • view

    13
  • download

    1

Embed Size (px)

description

Anda didiagnosa menderita tumor rahim?? Mencari Obat Tumor Rahim Selain Operasi?? Jelly Gamat Gold-G lah jawabannya, yaitu obat herbal penumpas tumor di rahim yang aman tanpa operasi dan tanpa efek samping. Terdaftar di BPOM RI, ber-sertfikat HALAL dari Malaysia, ber-Standar Pharmaceutical GMP, serta telah diakui oleh DEPKES Singapura (AVA). Harganya juga terjangkau, CUMA Rp.175.000,-/Botol (320 ml). Makanya, Buruan Pesan Sekarang Juga !!

Transcript of Obat Tumor Rahim Selain Operasi | OBAT KANKER RAHIM

  • OBATKANKERRAHIMPengobatanKankerRahimPalingAmpuh,Aman,TanpaEfekSamping

    14

    HomeKHASIATJELLYGAMATGOLD-GObatTumorRahimSelainOperasiObatTumorRahimSelainOperasi

    ObatTumorRahimSelainOperasiPostedonOctober27,2015byadminNoComments

    ObatTumorRahimSelainOperasiAndadidiagnosamenderitatumorrahim??MencariObatTumorRahimSelainOperasi??JellyGamatGold-Glahjawabannya,yaituobatherbalpenumpastumordirahimyangamantanpaoperasidantanpaefeksamping.TerdaftardiBPOMRI,ber-sertfikatHALALdar iMalaysia,ber-StandarPharmaceuticalGMP,sertatelahdiakuiolehDEPKESSingapura(AVA).Harganyajugaterjangkau,CUMARp.175.000,-/Botol(320ml).Makanya,BuruanPesanSekarangJuga!!

    MengenalPenyakitTumorRahim

    Tumorrahimadalahjenistumorjinakyangberkembangpadarahim,yaituorganreproduksiwanita.Tumoriniseringkalidijumpaipadawanitayangsudahmasukpubertas,dansangatjarangsekaliataubahkantidakditemukanpadawanitayangbelummemasukimasapubertas.Selainitutumorinihampirtidakditemukantumbuhberkembangmenjadibesarjikaterjadipadawanitayangsudahmemasukifasemenopouse.Danpenyakittumorrahiminibanyakmenyerangwanitayangberusiasekitar30tahun.

    Penyebabnya,tumorrahimseringkalidihubungkandenganstimulasihormonestrogenterhadaporganrahim.Adapunyangmenjadiindikasisebagaipenyebabtumorrahim,diantaranyaadalah:

    Berhentinyaproduksinormalsel-seldijaringantertentu.Genp53berhentimengirimkanpesanagarsel-seltertentumatipadawaktunya(apoptosis).Tumorakanterusberkembangdanmerusaksel-selsehinggatidakmampuberfungsisecaranormal.Adanyakerusakanselyangmembuatseltersebuttidaklagimampuberfungsisecaranormal.

    Ketiganyadapatterjadiakibatfaktorgayahidupyangburuk,terutamapeminumalkoholdanperokok.Selainitupenyebablainnyayangmenyebabkantumorrahimadalahkarenaobesitas,lingkungan,faktorgenetik,radiasiultravioletatauzatkimia,sertatingkatstressyangtinggi.

    Sementaraitugejalatumorrahimyangseringkalimuncul,diantaranyaadalah:

    Seringmengalamiperdarahanpadavagina.Adanyacairanabnormalyangkeluardarivagina.Seringmerasanyeriperutterutamapadaawal-awalsiklusmenstruasi.Perutterasatertekan.Terasaadabenjolankerasdibagianperut.

    InilahObatTumorRahimSelainOperasi

    Setiappenyakitadaobatnya.Makabilaobatitumengenai

    penyakitakansembuhdenganizinAllahAzzawaJalla.(HR.Muslim

    no.5705)

    searchhere GoGo

    PESAN1ATAU2BOTOLBOLEHTRANSFERPEMBAYARANSETELAH

    BARANGDITERIMA

    (JikaOngkosKirimnyaDiBawahRp.50.000)

    HIMBAUAN

    PEMBAYARANPRODUKSETELAHBARANG

    DITERIMAMAKSIMAL3HARI

    Diingatkanbagicalonpelanggankamiyangberitikadtidakbaikakanterkenasanksi:PASAL5BABIIINO.8TH1999,TuntutanHukumpidanadandendaan

    ataslanggarantidakmemenuhikewajibankonsumen.Bagikonsumen

    yangtidakbayarmakaakandicantumkandi100websitekamisebagaiorangyangbelumbayardanakan

    tetapadadandiketahuibanyakorangsampaiandamelunasinya.Terimakasih

    ZAHRAHERBAL

    HomeHome ACEMAXSACEMAXS JELLYGAMATGOLD-GJELLYGAMATGOLD-G LEGALITASLEGALITAS SITEMAPSITEMAP

  • Danuntukmengatasi,mengobatisertamenyembuhkanpenyakitkankerrahim,andabisamelakukanpengobatanselaindenganoperasi,yaitudenganmengkonsumsiobatyangampuhmenyembuhkantumorrahim.SalahsatunyaadalahobatherbalJellyGamatGold-G,yangsudahmemilikilegalitasresmidansudahbanyakterbuktikhasiatsertakeampuhannyadimatamasyarakat.Tidakhanyaitusaja,JellyGamatGold-Gjugasangatefektifdanamandalamprosespengobatannyatanpaefeksampingapapunsertatidakmenimbulkanketergantungan,karenadibuatdari100%bahanherbalalami.DanbahanyangdigunakandalampembuatanobatherbalJellyGamatGold-Giniadalahteripangemas,yangmerupakanteripangpilihanjenisterbaikdari1000jenislebihspesiesteripangyangpernahadadiseluruhdunia.

    JellyGamatGold-Gkamirekomendasikankepadaandayangtengahmenderitapenyakittumordirahim,karenamemangkandungan-kandunganyangterdapatpadateripangemasJellyGamatGold-Gtesebutmemilikimanfaatdankhasiatyangsangatbagusdancocoksekaliuntukpengobatantumorrahim.Danberikutinilahbeberapakandungan-kandungannya,antaralain:

    KandunganProteinLektinyangbersifatnetralterhadapgolongandarah,memilikiaktivitasanti-kankerdanmemilikiefekpositifterhadapperlawananterhadapvirusHIV,sertameningkatkanprosesAglutinasiyaituprosespembentukanantibodidariseranganbakteridanmikroorganisme.KandunganGlukosaminoglykan(GAGs)yangberkhasiatmeningkatkansistemkekebalantubuh,sertaberkhasiatsebagaianti-kankerdananti-tumor.KandunganSaponinyangberkhasiatsebagaiantioksidan,anti-mikrobadananti-kanker,sertamampumeningkatkansistemkekebalantubuh.KandunganGamapeptideyangberkhasiatuntukmencegahdanmengatasiinflamasiatauperadangan,mengurangirasasakit,3xmempercepatpenyembuhanluka,sertamengaktifkansel-sel.KandunganCellGrowthFactor(faktorregenerasisel),yangmampumeregenerasiataumemperbaikiselsertajaringantubuhyangrusakataubermasalah,ataubahkanselyangsudahmatidanmembusuksekalipun,hinggapulihkembali.

    Nah,dengankandungan-kandungantersebutyangmemilikimanfaatdankhasiatyangsangatbagusdancocokuntukpengobatantumorrahim,makatidakberlebihanjikakamisangatmerekomendasikanobatherbalJellyGamatGold-Ginisebagaisolusiuntukmengobatitumorrahimtanpamelakukanoperasi.Danselainkandungan-kandungandiatas,teripangemaspadaobatherbalJellyGamatGold-Ginijugamasihmemilikikandunganzatsertanutrisilainnya,diantaranya:

    Protein,MukopolisakaridadanKolagen.GlucosaminedanChondroitin.AntiseptikAlamiah.Omega-3,Omega-6,danOmega-9.AsamAmino,Magnesium,Fosfor,Zinc.Sodium,Cuprum,Potasium.VitamindanMineral.

    Jadi,ObatTumorRahimSelainOperasiyangsangattepatdancocokandagunakansebagaisolusiuntukmengatasi,mengobatidanmenyembuhkantumorrahimadalahobatherbalJellyGamatGold-G.Olehkarenaitu,segeralahpesanobatherbalJellyGamatGold-Ginisekarangjuga!

    CaraPemesananObatHerbalJellyGamatGold-G

    JikaAndaBerminatMemesanObatHerbalJellyGamatGold-GIni,SilahkanSMSDenganMenyertakanFormatPemesananSepertiBerikut:

    KamiAgenObatHerbalTerpercayaYangSiapMelayani

    Anda

    KamiBeralamatkanDi:

    KomplekKPKNJl.ArtamulyaVNo.57Kel.Kotabaru-Kec.Cibeureum-Tasikmalaya

    Tlp:(0265)341113

    KONSULTASI

    JikaAndaInginBerkonsultasiLangsung,AndaBisaHubungiKami

    MelaluiTelepon,SMS,YM,atauChat

    Telp:(0265)341113

    085223557127

    085323208590

    085793507222

    YM:fazryzahra@yahoo.com

    PinBB:27D0310B

    PRODUK&LEGALITAS

    JellyGamatGold-GRp.180.000/Botol

    Isi320ml

    LegalitasJellyGamatGold-G:

    TelahTerdaftardiBPOMRIDenganNomorRegistrasiTI

  • 14

    ObatHerbalUntukMengobatiInfeksiRahim

    ContohPemesanan:

    PGG-TR:4Botol:AbdulWahhab:Jl.AhmadYaniNo.14RT001RW012Kel.SukamanahKec.Cipedes,Tasikmalaya:085222444XXX

    Kirimke085793507222atauPIN27D0310B

    NP:

    PGG-TRadalahkodeprodukyangWAJIBdicantumkandalamformatpemesananJellyGamatGold-Gini,dankamiTIDAKMELAYANIpemesananTANPAKODEproduktersebut

    TerimaKasih

    DaftarHargaObatHerbalJellyGamatGold-G:

    Pembelian HargaRetail Discount HargaNet

    1btl Rp.180.000 Rp.5000 Rp.175.000+onkirSesuaitarifJNE1kg

    2btl Rp.360.000 Rp.50.000 Rp.310.000+ongkirSesuaitarifJNE1kg

    4btl Rp.720.000 Rp.120.000 Rp.600.000+Gratisongkir*

    8btl Rp.1.440.000 Rp.340.000 Rp.1.100.000+Gratisongkir**

    45btl(paketagen) Rp.4.158.000 ***Rp.4.158.000+Gratisongkir

    UntukPembayarannyaHarusMelaluiTransferKeSalahSatuRekeningKamiBerikutIni:

    NamaBank NoRekening AtasNama

    BankBCAKCPS.SenjayaTasikmalaya

    3210373712 RIPKIABDULROJAK

    BankBRICab.Tasikmalaya 0100-01-000304-56-3 RIPKIABDULROJAK

    BankBNICab.Tasikmalaya 0219391983 RIPKIABDULROJAK

    BankMuamalatCab.Tasikmalaya

    1510005196 RIPKIABDULROJAK

    BankMandiriKCOtistaTasikmalaya

    131-00-0565435-7 RIPKIABDULROJAK

    ObatTumorRahimSelainOperasiBacaJugaArtikelLainnya:

    ObatHerbalUntukMengobatiInfeksiRahimCaraMengobatiRadangPadaMulutRahimObatRadangMulutRahimHerbal

    PostedinObatTumorRahimSelainOperasi

    LeaveaReplyYouremailaddresswillnotbepublished.Requiredfieldsaremarked*

    Name*

    E-mail*

    114645721.MemilikisertifikatHALALdari

    DepatementofIslamicDevelopmentMalaysia.

    StandarPharmaceuticalGMP.TelahDiakuiAVASingapore(semacamDepartemen

    Kesehatan-nyaPemerintahSingapura).

    ===============================

    AceMaxsHerbalRp.240.000/Botol

    Isi350ml

    LegalitasAceMaxs:

    TelahTerdaftardiBPOMRIDenganNomorRegistrasiTR

    142680331.TelahTerdaftardiDEPKESRI,

    P-IRTNo.113317506253.

    ===============================

    VigPowerCapsuleRp.230.000/Botol

    Isi6Kapsul

    LegalitasVigPowerCapsule:

    1LikeLike

  • Website

    Comment

    PostCommentPostComment

    TelahTerdaftardiBPOMRIDenganNomorRegistrasiTI124

    346481.

    ===============================

    SlimmingCapsuleHerbalRp247.000,-/Botol

    Isi60Kapsul

    LegaitasSlimmingCapsule:

    TelahTerdaftardiBPOMRIDenganNomorRegistrasiTI124

    347171.

    BacaAturanPakaiPadaKemasan!!!JikaSakitBerlanjut,Hubungi

    Dokter!!!

    RecentPostsObatTumorRahimSelainOperasiOctober27,2015ObatHerbalUntukMengobatiInfeksiRahimOctober12,2015CaraMengobatiRadangPadaMulutRahimSeptember23,2015ObatRadangMulutRahimHerbalAugust21,2015PengobatanKistaRahimSelainDenganOperasiAugust5,2015

    Disclaimer

    "Perludiingat,bahwaPENGOBATANDENGANOBAT

    HERBALBUKANLAHPENGOBATANSEPERTIOBATDOKTER(obatmedis)yangbertugasmenekan

    symptoms(sumberamban

  • PengobatanTradisional

    penyakit).Tetapi,OBATHERBALhanyabertugassecaraalami

    membangun,me-regenarasi,me-recoverjaringan,organmaupun

    selyangtelahrusak,karenaOBATHERBALmerupakanHerbalfoodsupplemen.Olehsebabitulah,makahasilnyabersifatindividual(tiaporangberbeda-beda),dankecepatanperbaikansangat

    dipengaruhiolehfactorlingkungan,polamakan,tingkatkeparahanpenyakit,dankondisistress

    (mental)."

    Author

    Kamimenyadaribahwatidakadayangsempurnadantidakadaprodukdewayangadadimukabumiini,semuanyasemata-matahanyakarenaperanAllohSWTdalamberbagaideraplangkahkehidupanini,termasukdalamupayameng