Mod 4 Digitasi

download Mod 4 Digitasi

of 10

  • date post

    14-Aug-2015
  • Category

    Documents

  • view

    50
  • download

    2

Embed Size (px)

description

Digitizing using ILWIS

Transcript of Mod 4 Digitasi

Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana24

DigitasiLangkah pertama, import tabel data suvey. File --> Import --> TablePilih le data_survey.csv kemudian klik next --> Import Method gunakan Ilwis import , kemudian klik next --> Table Format gunakan Comma delimited, kemudian klik --> pada column detail ubah domain name dari string menjadi class, ubah newdomaindarinomenjadiyes,berikannamadomainmenjadidata_survey, kemudian pilih next --> gunakan nama data_survey untuk nama outputnya. Apabilaprosedurdiatastelahdilakukan,makaakanterlihattabledata_survey pada ilwis catalog. Klik kanan pada table data_survey kemudian pilih open. Pada table data survey kita dapat merubah urutan maupun panjang dari tiap kolom dengan mengklik dua kali tulisan column pada bagian atas yang kemudian akan memunculkan column properties. Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana25Untuklerepresentasidapat dilakukanklikkanandan memilihopenuntukmerubah warnarepresentasidaritiapjenis lahansesuaidengankebutuhan penggunaan.Untuk merubah data table menjadi peta point (format vektor) sehingga dapat di overlay dengan peta raster landsatyangakandiklasikasi, dilakukanprosestabletopoint map.Padaletabledata_surveylakukanklikkanan,pilihtableoperations-->pilih tabletopointmap.TampilanselanjutnyaadalahwindowTabletopointmap ,Xcolumndengancolumn3(koordinatX)danYcolumn(koordinatY.Ubah Coordinatesystemdenganutm48s_wgs84.Berikannamapetayangakan dihasilkan menjadi data_survey_point kemudian klik show. Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana26Untuk representasi yang akan ditampilkan yaitu titik dengan keterangan nama jenislahan,pilihsymbolsbyattributes,pilihclassuntukcolumn2,checklist kotak text dan gunakan untuk column 2, kemudian klik okKemudianlakukanoverlaydenganpetalandsat.Pilihaddlayer-->maplist landsat_stretch-->pilihOK-->pilihshowmaplistmenjadicolorcomposite. Tentukanredbanddariband5,greenbanddariband4,bluebanddariband 2.Dapatterlihatbahwatidaksemuadaerahdapatdilakukandigitasi,karena hanyasebagiandaerahsajayangdilakukanpengambilandatasurvey.Oleh sebabituuntukmengurangigeneralisasiterhadapdaerahlain(tidakdiambil data lapangan) dan untuk mempercepat kerja digitasi akan dilakukan cropping, sehingga hanya pada daerah yang tercover oleh titik data survey saja yang akan di digitasi.Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana27UntukmelakukancroppingpadaILWISdapatdilakukandenganmenentukan koordinatdarititik-titikterluaryangakandipergunakanpetalandsat.Pada pelatihanini,telahdilakukanpembatasandaerahsesuaidenganluasandari daerahdata_survey.AgardapatmemperolehkoordinattersebutlakukanFile --> Import --> Map --> pilih le frame.shp dan berikan nama output yang sama, yaitu frame --> OK.Koordinat tersebut (Min X, Y; Max X, Y) akan dijadikan titik koordinat acuan untuk melakukan cropping. Tahapanselanjutnyapembuatan Georeferencebaru,pilihFile--> Create --> Georeference. BerikannamacroppingpadaGeoreferenceName,kemudiangunakanGeoRef Corners.PilihcoordinateSystemsebagaiutm48s_wgs84.UntuknilaiMinX,Y danMaxX,Ymengikutinilaipadaframeyangtelahtersedia.kemudianklik OK.SetelahGeoreferencebaruterbentuk,prosesselanjutnyaadalahresampelpeta landsat agar memiliki nilai georeference yang sama dengan Georeference yang baru dibentuk. Klik kanan pada maplist landsat_stretch --> Image Processing --> Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana28Resample. Pilih resampling method Nearest Neighbour, kemudian output raster mapLandsat_stretch_crop,kemudianpilihGeoreferencecropping,klikshow. Overlaypetalandsatdenganpetapointdatasurvey,dapatterlihatluasandari peta landsat telah berkurang.Tahapan selanjutnya adalah melakukan digitasi. Gunakan tampilan peta landsat yang telah di crop sebagai background digitasi. Gunakan band 5 sebagai red band, band 4 sebagai green band, dan band 2 sebagai blue band. Tambahkan layer baru (add layer pada menu bar) yaitu data hasil survey lapangan yang telah di import sebagai acuan.Setelah tampilan pada peta seperti diatas, lakukan proses awal digitasi yaitu le --> create --> segment map. Berikan nama digit_segment kemudian klik OK. Sebelummelakukanprosesdigitasi,lakukanprosespengaturanyangakan mempengaruhi proses digitasi. Pada menu bar klik le --> customize. Selanjutnya akan muncul tampilan seperti berikut. Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana29Ubah nilai snap tolerance menjadi 30, nilai tolerance menjadi 2, dan nilai tunnel tolerence menjadi 0 yang diakhiri dengan klik OK. Untukmelakukanprosesdigitasiklikiconinsertmode.Padapraktekdigitasi ini,luasancitrayangdipergunakancukupbesarsehinggamenyulitkanapa-bilalangsungmelakukandigitasipadakeseluruhancitra.Untukmempermu-dah proses digitasi, lakukan proses zoom in pada daerah tertentu hingga dapat dilakukanpembedaanjenislahandenganbaik.Denganiconinsertmode,buat kotak untuk membatasi wilayah kerja digitasi. Lakukan dengan meng-klik kiri padasudut-sudutkotak,apabilainginmengakhiriprosespembuatanpolygon lakukan dengan meng - klik dua kali pada tombol kiri mouse. Seperti yang dapat dilihat apabila mengakhiri proses digitasi akan muncul win-dow attributes. Untuk sementara hiraukan window tersebut dan atur posisi win-dow attributes (dengan menarik ke posisi kiri) sepertigambardibawahiniagarmemudah-kan proses digitasi.Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana30Untuk melakukan digitasi pada software ILWIS dapat dilakukan dengan meng - klik pada sudut polygon atau dapat dengan menekan tombol kiri mouse dan menahannyakemudianmenjalankancursornyasehinggaprosesdigitasiakan lebihcepatdilakukansepertimenggambardenganalattulispadakertastulis, namun hal ini akan mengurangi tingkat ketelitian dari proses digitasi.Terlebihdahulu,tentukanjenislahanyangterdapatpadadaerahkotakyang telah dibuat kemudian tentukan batas dari jenis lahan tersebut dan mulai den-ganmempergunakaninsertmodepadabatasdaerahnya(dapatdilakukandi-manapun). Lakukan klik kiri pada mouse untuk memulai membuat polgygon dan arahkan kursor pada sudut selanjutnya hingga ditemui batas akhir polygon dari wilayah tersebut (gambar digitasi awal). Untukmerekatkan antara dua garis, usahakan untuk melakukan zoom in agar dapat diketahui dengan pasti bahwa garis telah bersatu dengan baik.Prosedur perekatan dapat dilakukan dengan dua cara, yaitu: menambahkan garis baru an-Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana31tara kedua jarak garis tersebut (add line) dan memindahkan salah satu garis agar mendekati garis lainnya (moving line). Padasaatkeduagarisakanbersatu,akanterjadiprosessnappingyangakan memunculkan window atas ini , klik YES. Tampilan tersebut juga akan muncul pada saat proses digitasi dimulai dari salah satu batas polygon.Lakukan digitasi hingga seluruh bagian kotak tertutup dengan polygon. Hal yang menarik dari proses digitasi di ILWIS adalah pengguna dapat melaku-kan proses pengecekan kesalahan yang dilakukan pada waktu digitasi agar taha-Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana32pan selanjutnya dapat dilakukan. Terdapat tiga jenis pengecekan error di ILWIS. Pertama adalah self overlap, pada menu bar pilih le -->check segments --> self overlap,yangberfungsiuntukpengecekanapabilaterjadikelebihansegment yang saling berhimpitan. Kedua adalah dead ends,pada menu bar pilih le --> check segments --> dead ends yang berfungsi untuk pengecekan apabila terjadi kelebihanpanjanggarissehinggakeduagaristidakbersatu.Ketigaadalahin-tersections, pada menu bar pilih le --> check segments --> intersections, yang berfungsiuntukmelakukanpengecekanapabilaseharusnya2garisataulebih yang berlainan disatukan pada satu titik terjadi kesalahan. Apabilaseluruhkesalahantelahdiperbaiki,langkahselanjutnyaadalah polygonize. Pada menu bar pilih File --> polygonize, yang akan memunculkan windows berikut ini. Ubah domain menjadi data_survey dan berikan nama pada output polygon map Pelatihan Pembuatan Peta Tutupan Lahan,Penggunaan Lahan dan Peta Kemiringan Untuk Manajement Bencana33menjadi digit_polygon kemudian klik ok. Untuk selanjutnya garis - garis polygon berubahmenjadihitam(bergantungpadapengaturan/costumizesegmentedi-tor).Untukmemberikanjeniskelaslahanpadatiappolygon,klikkiriduakali pada mouse maka akan diberikan pilihan jenis lahan apa yang ada pada polygon tersebut (sesuai dengan kelas data survey lapangan). Lakukan pada keseluruhan polygon yang terdapat pada kotak. Untuk mengakhiri proses digitasi dan meny-impannya, klik pada icon exit editor.